SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS20062
         (635 letters)

Database: spombe 
           5004 sequences; 2,362,478 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SPAC767.01c |vps1|SPAC9G1.14c|dynamin family protein Vps1|Schizo...   118   7e-28
SPBC12C2.08 |dnm1||dynamin Dnm1|Schizosaccharomyces pombe|chr 2|...   115   7e-27
SPBC1718.06 |msp1|mgm1|mitochondrial GTPase Msp1|Schizosaccharom...    76   5e-15
SPAC9G1.02 |wis4|wak1, wik1|MAP kinase kinase kinase Wis4|Schizo...    28   1.3  
SPAC186.02c |||hydroxyacid dehydrogenase |Schizosaccharomyces po...    27   2.3  
SPBC30D10.05c |||sepiapterin reductase |Schizosaccharomyces pomb...    26   4.0  
SPBC651.12c |||sequence orphan|Schizosaccharomyces pombe|chr 2||...    25   6.9  
SPAC4G8.15c |||dubious|Schizosaccharomyces pombe|chr 1|||Manual        25   6.9  
SPAC30D11.07 |nth1||DNA endonuclease III|Schizosaccharomyces pom...    25   6.9  

>SPAC767.01c |vps1|SPAC9G1.14c|dynamin family protein
           Vps1|Schizosaccharomyces pombe|chr 1|||Manual
          Length = 678

 Score =  118 bits (284), Expect = 7e-28
 Identities = 54/104 (51%), Positives = 78/104 (75%)
 Frame = +1

Query: 256 QQIKGMIFQFIRRESCLILAVTPANTDLANSDALKLAKEVDPQGLRTIGVITKLDLMDEG 435
           +QI+ M+ ++I + + +ILAV  ANTDLANSD LKLA+EVDP+GLRTIGV+TK+DLMD+G
Sbjct: 171 KQIREMVLKYISKNNAIILAVNAANTDLANSDGLKLAREVDPEGLRTIGVLTKVDLMDKG 230

Query: 436 TDARDVLENKLLPLRRGYIGVVNRCRKTLTVART*PLHLRLREN 567
           TD  D+L  +++PLR GY+ V+NR +K +   ++  + L    N
Sbjct: 231 TDVVDILAGRVIPLRLGYVPVINRGQKDIEGKKSIRIALEAERN 274



 Score =  109 bits (261), Expect = 4e-25
 Identities = 49/78 (62%), Positives = 61/78 (78%)
 Frame = +2

Query: 20  NGNTEYAEFLHCKGKKFTDFNEVRGEIEAETDRVTGSNKGISPVPINLRVYSPNVLNLTL 199
           N ++E+ EFLH  G+KF +F ++R EI  ET+  TG N GIS VPI LR+YSP+VL LTL
Sbjct: 92  NNSSEWGEFLHLPGQKFFEFEKIREEIVRETEEKTGKNVGISSVPIYLRIYSPHVLTLTL 151

Query: 200 IDLPGLTKVPIGDQPIDI 253
           +DLPGLTKVP+GDQP DI
Sbjct: 152 VDLPGLTKVPVGDQPRDI 169



 Score = 44.8 bits (101), Expect = 1e-05
 Identities = 21/36 (58%), Positives = 24/36 (66%)
 Frame = +3

Query: 510 QKDIDGRKDIAAALAAERKFFLSHPSYRHLADRLGT 617
           QKDI+G+K I  AL AER FF +HPSY   A   GT
Sbjct: 256 QKDIEGKKSIRIALEAERNFFETHPSYGSKAQYCGT 291


>SPBC12C2.08 |dnm1||dynamin Dnm1|Schizosaccharomyces pombe|chr
           2|||Manual
          Length = 781

 Score =  115 bits (276), Expect = 7e-27
 Identities = 52/74 (70%), Positives = 61/74 (82%)
 Frame = +2

Query: 32  EYAEFLHCKGKKFTDFNEVRGEIEAETDRVTGSNKGISPVPINLRVYSPNVLNLTLIDLP 211
           +YAEFLH    KFTD N+VR EIE ET RV G+NKGI+ +PINL++YS  VLNLTLIDLP
Sbjct: 113 DYAEFLHIPDTKFTDMNKVRAEIENETLRVAGANKGINKLPINLKIYSTRVLNLTLIDLP 172

Query: 212 GLTKVPIGDQPIDI 253
           GLTK+P+GDQP DI
Sbjct: 173 GLTKIPVGDQPTDI 186



 Score =  105 bits (251), Expect = 7e-24
 Identities = 45/88 (51%), Positives = 67/88 (76%)
 Frame = +1

Query: 259 QIKGMIFQFIRRESCLILAVTPANTDLANSDALKLAKEVDPQGLRTIGVITKLDLMDEGT 438
           Q + +I ++I R + +ILAV+PAN D+ NS+ LKLA+ VDP+G RTIGV+TKLDLMD+GT
Sbjct: 189 QTRSLIMEYISRPNSIILAVSPANFDIVNSEGLKLARSVDPKGKRTIGVLTKLDLMDQGT 248

Query: 439 DARDVLENKLLPLRRGYIGVVNRCRKTL 522
           +A D+L  ++ PL+ G++  VNR +  +
Sbjct: 249 NAMDILSGRVYPLKLGFVATVNRSQSDI 276



 Score = 39.9 bits (89), Expect = 3e-04
 Identities = 18/36 (50%), Positives = 22/36 (61%)
 Frame = +3

Query: 510 QKDIDGRKDIAAALAAERKFFLSHPSYRHLADRLGT 617
           Q DI   K +  AL +ER FF  HP+YR + DR GT
Sbjct: 273 QSDIVSHKSMRDALQSERSFFEHHPAYRTIKDRCGT 308


>SPBC1718.06 |msp1|mgm1|mitochondrial GTPase
           Msp1|Schizosaccharomyces pombe|chr 2|||Manual
          Length = 903

 Score = 75.8 bits (178), Expect = 5e-15
 Identities = 39/72 (54%), Positives = 51/72 (70%)
 Frame = +1

Query: 292 RESCLILAVTPANTDLANSDALKLAKEVDPQGLRTIGVITKLDLMDEGTDARDVLENKLL 471
           RE  +ILAV  A+ DLANS AL+ ++ VDP GLRTIGV+TK+DL+   + A  +L N   
Sbjct: 399 REPNIILAVCAADVDLANSAALRASRRVDPLGLRTIGVVTKMDLVPP-SKAISILHNNNY 457

Query: 472 PLRRGYIGVVNR 507
           PL  GYIGV++R
Sbjct: 458 PLHYGYIGVISR 469



 Score = 54.0 bits (124), Expect = 2e-08
 Identities = 26/73 (35%), Positives = 44/73 (60%)
 Frame = +2

Query: 35  YAEFLHCKGKKFTDFNEVRGEIEAETDRVTGSNKGISPVPINLRVYSPNVLNLTLIDLPG 214
           Y EF   +  K TDF++++  I  + +    S++G+   PI L +Y+ ++ NL+LIDLPG
Sbjct: 315 YGEFSGVQLGKITDFSKIQ-HILTDLNMAVPSSQGVDDNPIRLTIYASHIPNLSLIDLPG 373

Query: 215 LTKVPIGDQPIDI 253
             ++   DQP D+
Sbjct: 374 YIQIHSEDQPADL 386


>SPAC9G1.02 |wis4|wak1, wik1|MAP kinase kinase kinase
            Wis4|Schizosaccharomyces pombe|chr 1|||Manual
          Length = 1401

 Score = 27.9 bits (59), Expect = 1.3
 Identities = 16/45 (35%), Positives = 24/45 (53%), Gaps = 2/45 (4%)
 Frame = +2

Query: 101  EAETDRVTGSNKGISPVPI--NLRVYSPNVLNLTLIDLPGLTKVP 229
            +AETD +  S K  S +P+  N+ +  PN L +  I+LP     P
Sbjct: 1349 KAETDSLAASYKEESALPVASNVGLRQPNELRIDSINLPPAIVTP 1393


>SPAC186.02c |||hydroxyacid dehydrogenase |Schizosaccharomyces
           pombe|chr 1|||Manual
          Length = 332

 Score = 27.1 bits (57), Expect = 2.3
 Identities = 11/24 (45%), Positives = 16/24 (66%)
 Frame = +1

Query: 301 CLILAVTPANTDLANSDALKLAKE 372
           CL   +TP+ T + NSD+L L K+
Sbjct: 203 CLHCPLTPSTTHIVNSDSLALMKK 226


>SPBC30D10.05c |||sepiapterin reductase |Schizosaccharomyces
           pombe|chr 2|||Manual
          Length = 247

 Score = 26.2 bits (55), Expect = 4.0
 Identities = 17/57 (29%), Positives = 26/57 (45%), Gaps = 1/57 (1%)
 Frame = -3

Query: 228 GTFVRPGK-SISVRLSTFGE*TRRLIGTGDIPLLEPVTRSVSASISPRTSLKSVNFF 61
           G     GK SI   +  FG+    ++  G   +LEP+ +   A I+    L  +NFF
Sbjct: 59  GDVTEVGKASIETAIKKFGKLDSVILNAG---VLEPIAKIADADINEWRKLFDINFF 112


>SPBC651.12c |||sequence orphan|Schizosaccharomyces pombe|chr
           2|||Manual
          Length = 273

 Score = 25.4 bits (53), Expect = 6.9
 Identities = 10/23 (43%), Positives = 15/23 (65%)
 Frame = +1

Query: 295 ESCLILAVTPANTDLANSDALKL 363
           E C +L +  +NTD+ NS +L L
Sbjct: 232 EKCTVLLLKRSNTDVDNSSSLSL 254


>SPAC4G8.15c |||dubious|Schizosaccharomyces pombe|chr 1|||Manual
          Length = 46

 Score = 25.4 bits (53), Expect = 6.9
 Identities = 13/45 (28%), Positives = 24/45 (53%)
 Frame = -2

Query: 247 YRLITDWHFCQTRQINQRQVEHIRGINTQVNRYRRYTLVGTSNTI 113
           Y +    H     Q N+R++ HI  + T+ +RY +  ++ + NTI
Sbjct: 3   YEIFIMQHLLIKSQSNERKITHIFHMLTKFDRYSK-MILNSINTI 46


>SPAC30D11.07 |nth1||DNA endonuclease III|Schizosaccharomyces
           pombe|chr 1|||Manual
          Length = 355

 Score = 25.4 bits (53), Expect = 6.9
 Identities = 13/48 (27%), Positives = 23/48 (47%)
 Frame = -2

Query: 250 IYRLITDWHFCQTRQINQRQVEHIRGINTQVNRYRRYTLVGTSNTICL 107
           ++R+    H+C T+   Q +      +  ++     +TLVG   TICL
Sbjct: 164 VHRICNLLHWCNTKTEEQTRAALQSWLPKELWFELNHTLVGFGQTICL 211


  Database: spombe
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 2,362,478
  Number of sequences in database:  5004
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 2,541,053
Number of Sequences: 5004
Number of extensions: 48982
Number of successful extensions: 137
Number of sequences better than 10.0: 9
Number of HSP's better than 10.0 without gapping: 127
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 136
length of database: 2,362,478
effective HSP length: 70
effective length of database: 2,012,198
effective search space used: 283719918
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -