SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS20060
         (530 letters)

Database: spombe 
           5004 sequences; 2,362,478 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SPAC959.08 |rpl2102|rpl21-2, rpl21|60S ribosomal protein L21|Sch...   103   1e-23
SPBC365.03c |rpl2101|rpl21, rpl21-1|60S ribosomal protein L21|Sc...   103   2e-23
SPAC7D4.12c |||DUF1212 family protein|Schizosaccharomyces pombe|...    29   0.57 
SPAC4D7.13 |usp104|prp40|U1 snRNP-associated protein Usp104|Schi...    26   3.0  
SPAC1F3.10c |oct1||mitochondrial intermediate peptidase Oct1 |Sc...    25   5.3  
SPAC17A2.04c |||HSP chaperone complex subunit |Schizosaccharomyc...    25   7.0  
SPAC9E9.06c |||threonine synthase |Schizosaccharomyces pombe|chr...    25   7.0  
SPAC17G6.13 |||sequence orphan|Schizosaccharomyces pombe|chr 1||...    25   7.0  
SPAC5D6.02c |mug165||sequence orphan|Schizosaccharomyces pombe|c...    25   7.0  
SPCC191.05c |||nucleoside 2-deoxyribosyltransferase |Schizosacch...    25   9.3  
SPBC1734.03 ||SPBC337.19|dihydropteroatesynthase/2-amino-4-hydro...    25   9.3  
SPAC328.04 |||AAA family ATPase, unknown biological role|Schizos...    25   9.3  
SPBC1773.01 |||striatin homolog|Schizosaccharomyces pombe|chr 2|...    25   9.3  
SPBP35G2.13c |swc2||chromatin remodeling complex subunit Swc2 |S...    25   9.3  
SPAC9E9.12c |ybt1|abc1|ABC transporter Ybt1|Schizosaccharomyces ...    25   9.3  
SPBC530.06c |||translation initiation factor eIF3 alpha subunit ...    25   9.3  

>SPAC959.08 |rpl2102|rpl21-2, rpl21|60S ribosomal protein
           L21|Schizosaccharomyces pombe|chr 1|||Manual
          Length = 160

 Score =  103 bits (248), Expect = 1e-23
 Identities = 49/78 (62%), Positives = 57/78 (73%), Gaps = 1/78 (1%)
 Frame = +2

Query: 260 VRGRIIPKRINIRVEHVKHSKCRQDFLKRVKENERLLKEAKAAGKTVNLKRQPAPPKAAH 439
           V  R + KR+N+R+EHVKHSKCRQDFL RVK NE   KEAKA GKTV L+RQPAPP  AH
Sbjct: 80  VGNRYMEKRVNVRIEHVKHSKCRQDFLDRVKANEAKRKEAKAQGKTVQLRRQPAPPATAH 139

Query: 440 IVS-GTEKPVLLAPIPYE 490
            VS    +PV L P+ Y+
Sbjct: 140 FVSTENNEPVTLHPVAYD 157



 Score = 99.1 bits (236), Expect = 4e-22
 Identities = 46/74 (62%), Positives = 55/74 (74%)
 Frame = +3

Query: 39  GLPXRHQGLVRSQFRTHGTIPLSTYMKVYKVGDIVDIRGNGAVQKGMPHKVYHGKTGRVY 218
           G+  R +   +  FR HG I LSTY+K YKVGDIVDI+ NGAVQKGMPHK YHGKTG VY
Sbjct: 6   GIRARTRYTFQRGFREHGQIRLSTYLKTYKVGDIVDIKVNGAVQKGMPHKYYHGKTGVVY 65

Query: 219 NVTAHALGVIVNSV 260
           NVT  ++GV++  V
Sbjct: 66  NVTQSSVGVLIYKV 79


>SPBC365.03c |rpl2101|rpl21, rpl21-1|60S ribosomal protein
           L21|Schizosaccharomyces pombe|chr 2|||Manual
          Length = 160

 Score =  103 bits (247), Expect = 2e-23
 Identities = 49/78 (62%), Positives = 57/78 (73%), Gaps = 1/78 (1%)
 Frame = +2

Query: 260 VRGRIIPKRINIRVEHVKHSKCRQDFLKRVKENERLLKEAKAAGKTVNLKRQPAPPKAAH 439
           V  R + KR+N+R+EHVKHSKCRQDFL RVK NE   KEAKA GKTV L+RQPAPP  AH
Sbjct: 80  VGNRYMEKRVNVRIEHVKHSKCRQDFLDRVKANEAKRKEAKAQGKTVQLRRQPAPPAKAH 139

Query: 440 IVS-GTEKPVLLAPIPYE 490
            VS    +PV L P+ Y+
Sbjct: 140 FVSTENNEPVTLHPVAYD 157



 Score = 99.1 bits (236), Expect = 4e-22
 Identities = 46/74 (62%), Positives = 55/74 (74%)
 Frame = +3

Query: 39  GLPXRHQGLVRSQFRTHGTIPLSTYMKVYKVGDIVDIRGNGAVQKGMPHKVYHGKTGRVY 218
           G+  R +   +  FR HG I LSTY+K YKVGDIVDI+ NGAVQKGMPHK YHGKTG VY
Sbjct: 6   GIRARTRYTFQRGFREHGQIRLSTYLKTYKVGDIVDIKVNGAVQKGMPHKYYHGKTGVVY 65

Query: 219 NVTAHALGVIVNSV 260
           NVT  ++GV++  V
Sbjct: 66  NVTQSSVGVLIYKV 79


>SPAC7D4.12c |||DUF1212 family protein|Schizosaccharomyces pombe|chr
           1|||Manual
          Length = 759

 Score = 28.7 bits (61), Expect = 0.57
 Identities = 21/69 (30%), Positives = 37/69 (53%), Gaps = 5/69 (7%)
 Frame = -2

Query: 463 GFLSSTDDVGSFRGSWLSLQVDGLAGSL-GFLQ*PL----ILFDSLKEVLSALGVLDMLN 299
           GF S+T    SF+G W+ L +  + G L G LQ  +     +++SL EV  ++ +   L+
Sbjct: 445 GFASATILPMSFQGGWIDLPIAFILGCLVGILQHYIAPRSTMYNSLFEVTGSI-ITSFLS 503

Query: 298 TDIDALRYN 272
               ++RY+
Sbjct: 504 RAFGSIRYS 512


>SPAC4D7.13 |usp104|prp40|U1 snRNP-associated protein
           Usp104|Schizosaccharomyces pombe|chr 1|||Manual
          Length = 695

 Score = 26.2 bits (55), Expect = 3.0
 Identities = 11/35 (31%), Positives = 15/35 (42%)
 Frame = +2

Query: 95  YSALHVHESVQSWRHCRHQRQWCSSKGYATQSIPW 199
           +  L  H    SW   +  R+ C +KGY     PW
Sbjct: 199 FKFLDSHNVNPSWTWEQTVRELCDAKGYYVMKDPW 233


>SPAC1F3.10c |oct1||mitochondrial intermediate peptidase Oct1
           |Schizosaccharomyces pombe|chr 1|||Manual
          Length = 762

 Score = 25.4 bits (53), Expect = 5.3
 Identities = 17/59 (28%), Positives = 29/59 (49%), Gaps = 2/59 (3%)
 Frame = +3

Query: 180 PHKVYHGKTGRV--YNVTAHALGVIVNSVFAEGLYRSASISVLSMSSTPSADKTSLRES 350
           P +V+H    +V  YN   H +GVI   +FA    ++   +  ++ S+   D TS  +S
Sbjct: 436 PGEVWHPDVNKVNVYNENDHVMGVIYFDLFAR-TGKTDGAAHFTIRSSRELDLTSFDDS 493


>SPAC17A2.04c |||HSP chaperone complex subunit |Schizosaccharomyces
           pombe|chr 1|||Manual
          Length = 358

 Score = 25.0 bits (52), Expect = 7.0
 Identities = 14/32 (43%), Positives = 17/32 (53%)
 Frame = +2

Query: 320 KCRQDFLKRVKENERLLKEAKAAGKTVNLKRQ 415
           K   DF KR  E +R+ +E   A KTV L  Q
Sbjct: 181 KKSDDFEKRESEKKRVAQEKVIAAKTVLLALQ 212


>SPAC9E9.06c |||threonine synthase |Schizosaccharomyces pombe|chr
           1|||Manual
          Length = 514

 Score = 25.0 bits (52), Expect = 7.0
 Identities = 28/87 (32%), Positives = 38/87 (43%), Gaps = 6/87 (6%)
 Frame = +3

Query: 93  TIPLSTYMKVYKVGDIVDIR-----GN-GAVQKGMPHKVYHGKTGRVYNVTAHALGVIVN 254
           T  L +Y+ VYK G   D+R     GN G +  G   K     T ++  V A     I+N
Sbjct: 245 TYYLYSYLSVYKQGKADDVRFIVPTGNFGDILAGYYAKRMGLPTKQL--VIATNENDILN 302

Query: 255 SVFAEGLYRSASISVLSMSSTPSADKT 335
             F  G Y  A  + +S S   SA +T
Sbjct: 303 RFFKTGRYEKADSTQVSPSGPISAKET 329


>SPAC17G6.13 |||sequence orphan|Schizosaccharomyces pombe|chr
           1|||Manual
          Length = 433

 Score = 25.0 bits (52), Expect = 7.0
 Identities = 10/27 (37%), Positives = 15/27 (55%)
 Frame = +2

Query: 374 EAKAAGKTVNLKRQPAPPKAAHIVSGT 454
           + KA  K  +  +QP+PP A H  + T
Sbjct: 344 DTKAGEKLTDSSKQPSPPVAEHFSNET 370


>SPAC5D6.02c |mug165||sequence orphan|Schizosaccharomyces pombe|chr
           1|||Manual
          Length = 300

 Score = 25.0 bits (52), Expect = 7.0
 Identities = 17/61 (27%), Positives = 30/61 (49%)
 Frame = +3

Query: 282 SASISVLSMSSTPSADKTSLRESKRMRGY*RKPRLPARPST*RDSQLPLKLPTSSVELRN 461
           SAS S  S++S+ S D  ++   +R R   RKP +  +P+  +  + P  + T   +   
Sbjct: 56  SASRSPESIASSQSNDSAAIPSYRRKRRKVRKPEI-VKPTLRKRGRKPKNISTLEHDKSK 114

Query: 462 P 464
           P
Sbjct: 115 P 115


>SPCC191.05c |||nucleoside 2-deoxyribosyltransferase
           |Schizosaccharomyces pombe|chr 3|||Manual
          Length = 211

 Score = 24.6 bits (51), Expect = 9.3
 Identities = 13/27 (48%), Positives = 15/27 (55%)
 Frame = -2

Query: 394 LAGSLGFLQ*PLILFDSLKEVLSALGV 314
           LAG L F    + LFD LKE+    GV
Sbjct: 22  LAGDLVFRPNAIELFDELKEICKDAGV 48


>SPBC1734.03 ||SPBC337.19|dihydropteroatesynthase/2-amino-4-hydroxy-
           6-
           hydroxymethyldihydropteridinediphosphokinase/dihydroneop
           terinaldolase|Schizosaccharomyces pombe|chr 2|||Manual
          Length = 686

 Score = 24.6 bits (51), Expect = 9.3
 Identities = 11/43 (25%), Positives = 19/43 (44%)
 Frame = -1

Query: 218 VHATCLSMVYFVWHTLLNCTIASDVYNVSNFVHFHVRGERNSS 90
           + + C   V    H  +  T+   V    N +H++   ERNS+
Sbjct: 83  IASLCFEDVIDTSHVSIKLTLPKCVLRSKNGLHYYAERERNST 125


>SPAC328.04 |||AAA family ATPase, unknown biological
           role|Schizosaccharomyces pombe|chr 1|||Manual
          Length = 741

 Score = 24.6 bits (51), Expect = 9.3
 Identities = 10/15 (66%), Positives = 14/15 (93%)
 Frame = +3

Query: 303 SMSSTPSADKTSLRE 347
           SMSS+P+A +TSLR+
Sbjct: 163 SMSSSPTASRTSLRK 177


>SPBC1773.01 |||striatin homolog|Schizosaccharomyces pombe|chr
           2|||Manual
          Length = 612

 Score = 24.6 bits (51), Expect = 9.3
 Identities = 15/44 (34%), Positives = 20/44 (45%), Gaps = 1/44 (2%)
 Frame = +2

Query: 341 KRVKENERLLK-EAKAAGKTVNLKRQPAPPKAAHIVSGTEKPVL 469
           K+ KE +  LK E+     T  +  QP P       SGTE  V+
Sbjct: 269 KKKKEQKWTLKFESDKGTSTQCITHQPLPGSTPSFASGTENGVI 312


>SPBP35G2.13c |swc2||chromatin remodeling complex subunit Swc2
           |Schizosaccharomyces pombe|chr 2|||Manual
          Length = 316

 Score = 24.6 bits (51), Expect = 9.3
 Identities = 12/41 (29%), Positives = 20/41 (48%)
 Frame = +2

Query: 341 KRVKENERLLKEAKAAGKTVNLKRQPAPPKAAHIVSGTEKP 463
           K +++ ER+ K      +  NL+R   PPK     + +E P
Sbjct: 83  KILRDEERIKKRKIQKNRAANLQRTLQPPKRPTPSAASEVP 123


>SPAC9E9.12c |ybt1|abc1|ABC transporter Ybt1|Schizosaccharomyces
            pombe|chr 1|||Manual
          Length = 1427

 Score = 24.6 bits (51), Expect = 9.3
 Identities = 7/15 (46%), Positives = 13/15 (86%)
 Frame = -2

Query: 418  WLSLQVDGLAGSLGF 374
            WL+++ DG++G +GF
Sbjct: 1085 WLAIRTDGISGLVGF 1099


>SPBC530.06c |||translation initiation factor eIF3 alpha subunit
           |Schizosaccharomyces pombe|chr 2|||Manual
          Length = 1173

 Score = 24.6 bits (51), Expect = 9.3
 Identities = 8/17 (47%), Positives = 12/17 (70%)
 Frame = +3

Query: 207 GRVYNVTAHALGVIVNS 257
           G+ YN+T+H  G  VN+
Sbjct: 234 GKTYNITSHVSGFYVNN 250


  Database: spombe
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 2,362,478
  Number of sequences in database:  5004
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 2,150,313
Number of Sequences: 5004
Number of extensions: 42582
Number of successful extensions: 164
Number of sequences better than 10.0: 16
Number of HSP's better than 10.0 without gapping: 158
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 164
length of database: 2,362,478
effective HSP length: 68
effective length of database: 2,022,206
effective search space used: 218398248
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -