SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS20058
         (614 letters)

Database: spombe 
           5004 sequences; 2,362,478 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SPBC3B9.07c |rpa43|rpa21|DNA-directed RNA polymerase I complex s...    44   2e-05
SPBC3H7.05c |||sequence orphan|Schizosaccharomyces pombe|chr 2||...    27   2.8  
SPAC24B11.11c |sid2||Sid2p-Mob1p kinase complex|Schizosaccharomy...    26   5.0  
SPAC328.08c |||tubulin specific chaperone cofactor C |Schizosacc...    25   6.6  
SPBC1289.07c |rpc40|rpa42|DNA-directed RNA polymerase I and III ...    25   6.6  
SPBC216.05 |rad3||ATR checkpoint kinase|Schizosaccharomyces pomb...    25   8.7  
SPAC17C9.01c |nuc2|apc3, SPAC1851.01|anaphase-promoting complex ...    25   8.7  

>SPBC3B9.07c |rpa43|rpa21|DNA-directed RNA polymerase I complex
           subunit Rpa43|Schizosaccharomyces pombe|chr 2|||Manual
          Length = 173

 Score = 44.0 bits (99), Expect = 2e-05
 Identities = 24/82 (29%), Positives = 42/82 (51%)
 Frame = +3

Query: 261 LNGVLVSYKNPCILQNVGTIRNDNADIHFQVQADYFIFQPYIGAKLTGLVNKKCSTHLSV 440
           +NG++++Y N   L+    +  D+      V+ D  +F P  G  L G +N    +H+ +
Sbjct: 44  INGIVLAYDNIRFLEKSAKVMYDSPFSFIWVRVDVLVFSPKKGDCLEGKINLVSPSHIGL 103

Query: 441 LVHRVFNVVIPQPTEEPGDKWI 506
           L+  +FN  IP+ +  P D WI
Sbjct: 104 LILGIFNASIPRKS-IPKD-WI 123


>SPBC3H7.05c |||sequence orphan|Schizosaccharomyces pombe|chr
           2|||Manual
          Length = 357

 Score = 26.6 bits (56), Expect = 2.8
 Identities = 10/17 (58%), Positives = 13/17 (76%)
 Frame = -1

Query: 131 FANCFNSRRSNFMILDI 81
           F NCF +R SN+M+L I
Sbjct: 167 FVNCFKTRLSNWMLLPI 183


>SPAC24B11.11c |sid2||Sid2p-Mob1p kinase complex|Schizosaccharomyces
           pombe|chr 1|||Manual
          Length = 607

 Score = 25.8 bits (54), Expect = 5.0
 Identities = 17/59 (28%), Positives = 28/59 (47%)
 Frame = +3

Query: 300 LQNVGTIRNDNADIHFQVQADYFIFQPYIGAKLTGLVNKKCSTHLSVLVHRVFNVVIPQ 476
           L  +G I  D    +F V A   I     G   +G+++KK    + + +  V NVV+P+
Sbjct: 322 LHQLGYIHRDLKPENFLVGASGHIKLTDFGLS-SGIISKKKIESMKIRLQEVNNVVVPE 379


>SPAC328.08c |||tubulin specific chaperone cofactor C
           |Schizosaccharomyces pombe|chr 1|||Manual
          Length = 259

 Score = 25.4 bits (53), Expect = 6.6
 Identities = 8/18 (44%), Positives = 13/18 (72%)
 Frame = +2

Query: 332 CGYTFPSSSGLLHISTIH 385
           C +TFP+  G +H+S I+
Sbjct: 172 CNFTFPTIQGSIHLSDIN 189


>SPBC1289.07c |rpc40|rpa42|DNA-directed RNA polymerase I and III
           subunit Rpc40 |Schizosaccharomyces pombe|chr 2|||Manual
          Length = 348

 Score = 25.4 bits (53), Expect = 6.6
 Identities = 12/30 (40%), Positives = 19/30 (63%)
 Frame = +1

Query: 91  IIKFDLRELKQLANDKNSCLVVKKITQNLA 180
           I+K D+  +K +A  K+ CL VK   QN++
Sbjct: 317 IMKPDVLFIKSIAVLKSKCLAVKSSLQNIS 346


>SPBC216.05 |rad3||ATR checkpoint kinase|Schizosaccharomyces pombe|chr
            2|||Manual
          Length = 2386

 Score = 25.0 bits (52), Expect = 8.7
 Identities = 13/32 (40%), Positives = 20/32 (62%), Gaps = 6/32 (18%)
 Frame = -2

Query: 172  FV*SFLQPN------KNFCRLPTVLTLVGQIL 95
            FV SF +PN      +N+CR   V+++VG +L
Sbjct: 2195 FVESFPEPNNWVTSRQNYCRTLAVMSIVGYVL 2226


>SPAC17C9.01c |nuc2|apc3, SPAC1851.01|anaphase-promoting complex
           subunit Apc3|Schizosaccharomyces pombe|chr 1|||Manual
          Length = 665

 Score = 25.0 bits (52), Expect = 8.7
 Identities = 15/45 (33%), Positives = 22/45 (48%), Gaps = 2/45 (4%)
 Frame = +3

Query: 315 TIRNDNADIHFQVQADYFIFQPYIGAKLT--GLVNKKCSTHLSVL 443
           T RND AD HFQ  A+     P     +T  G++ ++C  +   L
Sbjct: 512 TGRNDQADFHFQRAAE---INPNNSVLITCIGMIYERCKDYKKAL 553


  Database: spombe
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 2,362,478
  Number of sequences in database:  5004
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 2,411,583
Number of Sequences: 5004
Number of extensions: 48423
Number of successful extensions: 86
Number of sequences better than 10.0: 7
Number of HSP's better than 10.0 without gapping: 86
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 86
length of database: 2,362,478
effective HSP length: 70
effective length of database: 2,012,198
effective search space used: 269634532
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -