SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS20057
         (573 letters)

Database: spombe 
           5004 sequences; 2,362,478 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SPAC1687.05 |pli1||SUMO E3 ligase Pli1|Schizosaccharomyces pombe...    28   0.84 
SPAC6G9.04 |mug79||meiotically upregulated gene Mug79|Schizosacc...    28   1.1  
SPBC26H8.09c |snf59||SWI/SNF complex subunit Snf59|Schizosacchar...    27   1.5  
SPBC3F6.04c |||U3 snoRNP protein Nop14 |Schizosaccharomyces pomb...    27   2.6  
SPBC2G2.11 |||N-myristoyltransferase 1|Schizosaccharomyces pombe...    27   2.6  
SPBC25H2.09 |||DUF1690 family protein|Schizosaccharomyces pombe|...    27   2.6  
SPAC19G12.10c |cpy1|pcy1|vacuolar carboxypeptidase Y|Schizosacch...    26   3.4  
SPAC15A10.04c |zpr1||zinc finger protein Zpr1|Schizosaccharomyce...    26   4.5  
SPAC6F12.15c |cut9|dre1|anaphase-promoting complex subunit Cut9|...    26   4.5  
SPBC23G7.12c |rpt6|let1|19S proteasome regulatory subunit Rpt6|S...    25   6.0  
SPBC1D7.04 |mlo3||RNA annealing factor Mlo3|Schizosaccharomyces ...    25   6.0  

>SPAC1687.05 |pli1||SUMO E3 ligase Pli1|Schizosaccharomyces
           pombe|chr 1|||Manual
          Length = 727

 Score = 28.3 bits (60), Expect = 0.84
 Identities = 17/62 (27%), Positives = 26/62 (41%)
 Frame = +3

Query: 336 PPQHQEHETQNPEHHEDAEKIVSSVKNDINTAEIALRQGFQEVSDGIGKWYARTEQIKSS 515
           PP H ++ TQ    HEDA+    S  + +    I  R  ++      G +    EQ  S+
Sbjct: 609 PPLHLKNTTQTNNAHEDAQSSNLSQNHSLFYERIPQRPSYRIEKQNKGIYEDENEQSISA 668

Query: 516 RP 521
            P
Sbjct: 669 MP 670


>SPAC6G9.04 |mug79||meiotically upregulated gene
           Mug79|Schizosaccharomyces pombe|chr 1|||Manual
          Length = 1318

 Score = 27.9 bits (59), Expect = 1.1
 Identities = 22/105 (20%), Positives = 52/105 (49%)
 Frame = +1

Query: 79  KVPEAEDKPLNVVDNLSSEQELIDQANTIKDIDNSLRANKKEVIDIPVKVIVEEIKPSLR 258
           K P +E  P   V  L+ +   I    +I +++ +  ++  +V++ P + ++ +I+ +  
Sbjct: 377 KAPTSEAPPKGHVKQLAKQLGNIYMPQSINNVEPTSHSSISKVVN-PSEKVISKIERACL 435

Query: 259 VI*KTLKCRMKMRKSRGL*SI*EIPGPRSIKSTKHRILNTTKMLK 393
                +   +KM K+  L      P PR++ +T+H+I +  ++ K
Sbjct: 436 AGNGNVHPSIKMEKNLEL-----NPHPRTLNATEHKINSRIQVSK 475


>SPBC26H8.09c |snf59||SWI/SNF complex subunit
           Snf59|Schizosaccharomyces pombe|chr 2|||Manual
          Length = 515

 Score = 27.5 bits (58), Expect = 1.5
 Identities = 17/71 (23%), Positives = 33/71 (46%), Gaps = 6/71 (8%)
 Frame = +3

Query: 240 NQTVVKSDLENVEVPDENEEIK----RPLVDLRNPGPPQHQEHETQNPEHHEDA--EKIV 401
           N+     D  N++  +  +  K    +P  D RN GP Q  + + + PE H ++  E+ +
Sbjct: 125 NKESTNLDNSNMDESENQKNFKIEEPKPSGDFRNEGPKQCDDSKIEKPELHVNSKIEEPI 184

Query: 402 SSVKNDINTAE 434
             + ++ N  E
Sbjct: 185 HRIDSEHNEPE 195


>SPBC3F6.04c |||U3 snoRNP protein Nop14 |Schizosaccharomyces
           pombe|chr 2|||Manual
          Length = 827

 Score = 26.6 bits (56), Expect = 2.6
 Identities = 9/29 (31%), Positives = 18/29 (62%)
 Frame = +3

Query: 339 PQHQEHETQNPEHHEDAEKIVSSVKNDIN 425
           P +++  T++ E HED +  V  +++D N
Sbjct: 24  PNNKKSRTRSTESHEDRQAKVQKIQSDFN 52


>SPBC2G2.11 |||N-myristoyltransferase 1|Schizosaccharomyces
           pombe|chr 2|||Manual
          Length = 466

 Score = 26.6 bits (56), Expect = 2.6
 Identities = 12/36 (33%), Positives = 18/36 (50%)
 Frame = +1

Query: 328 IPGPRSIKSTKHRILNTTKMLKKSFLPSKMTLTQRK 435
           +P P S+    HR LN  K+    F P  +  T++K
Sbjct: 224 LPSPVSLSRYMHRSLNWKKLYDIGFAPFPLGSTEKK 259


>SPBC25H2.09 |||DUF1690 family protein|Schizosaccharomyces pombe|chr
           2|||Manual
          Length = 162

 Score = 26.6 bits (56), Expect = 2.6
 Identities = 18/79 (22%), Positives = 38/79 (48%)
 Frame = +1

Query: 55  HAQPAIPDKVPEAEDKPLNVVDNLSSEQELIDQANTIKDIDNSLRANKKEVIDIPVKVIV 234
           + Q  + D++ + + +    +D +  E+E    A TIKD   SL +N   ++    +   
Sbjct: 43  YIQKRVQDELKQLQLRQKKAIDAIQ-EEEWKSNAKTIKDSQGSLDSN---LLSAEFRSFQ 98

Query: 235 EEIKPSLRVI*KTLKCRMK 291
           E+++    +  K LK ++K
Sbjct: 99  EKLEKQSSINDKELKIKLK 117


>SPAC19G12.10c |cpy1|pcy1|vacuolar carboxypeptidase
           Y|Schizosaccharomyces pombe|chr 1|||Manual
          Length = 1002

 Score = 26.2 bits (55), Expect = 3.4
 Identities = 13/49 (26%), Positives = 23/49 (46%)
 Frame = +3

Query: 261 DLENVEVPDENEEIKRPLVDLRNPGPPQHQEHETQNPEHHEDAEKIVSS 407
           D E+ + P + E  K P     + GP   + H+    +H+E  E+ + S
Sbjct: 388 DKEHHKGPKDKEHHKGPKDKEHHKGPKDKEHHQGPKEKHNERPEQNMQS 436


>SPAC15A10.04c |zpr1||zinc finger protein Zpr1|Schizosaccharomyces
           pombe|chr 1|||Manual
          Length = 459

 Score = 25.8 bits (54), Expect = 4.5
 Identities = 20/53 (37%), Positives = 27/53 (50%), Gaps = 8/53 (15%)
 Frame = +1

Query: 109 NVVDNLSSEQE--------LIDQANTIKDIDNSLRANKKEVIDIPVKVIVEEI 243
           NVVD+LS EQE        L DQ N   +  NSLR+       +P  + V++I
Sbjct: 137 NVVDDLSKEQESRKESAPQLYDQINAFIEKVNSLRSG-----SVPFTITVDDI 184


>SPAC6F12.15c |cut9|dre1|anaphase-promoting complex subunit
           Cut9|Schizosaccharomyces pombe|chr 1|||Manual
          Length = 671

 Score = 25.8 bits (54), Expect = 4.5
 Identities = 10/14 (71%), Positives = 11/14 (78%)
 Frame = -2

Query: 521 WPGALNLLGTSVPF 480
           W GALNLLG + PF
Sbjct: 166 WQGALNLLGETNPF 179


>SPBC23G7.12c |rpt6|let1|19S proteasome regulatory subunit
           Rpt6|Schizosaccharomyces pombe|chr 2|||Manual
          Length = 403

 Score = 25.4 bits (53), Expect = 6.0
 Identities = 10/21 (47%), Positives = 16/21 (76%)
 Frame = +1

Query: 199 KEVIDIPVKVIVEEIKPSLRV 261
           K V+DI   + ++EIKP++RV
Sbjct: 90  KYVVDISPDIDIKEIKPNIRV 110


>SPBC1D7.04 |mlo3||RNA annealing factor Mlo3|Schizosaccharomyces
           pombe|chr 2|||Manual
          Length = 199

 Score = 25.4 bits (53), Expect = 6.0
 Identities = 15/48 (31%), Positives = 25/48 (52%)
 Frame = +1

Query: 331 PGPRSIKSTKHRILNTTKMLKKSFLPSKMTLTQRKSLFVKASRKCQTV 474
           P   +  + K  I   +K++  + LP+ +T  Q K LFVK+   C+ V
Sbjct: 39  PAVNTASALKSVISEESKIIVSN-LPTDVTEAQVKELFVKSIGPCKRV 85


  Database: spombe
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 2,362,478
  Number of sequences in database:  5004
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 1,976,141
Number of Sequences: 5004
Number of extensions: 36426
Number of successful extensions: 165
Number of sequences better than 10.0: 11
Number of HSP's better than 10.0 without gapping: 158
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 165
length of database: 2,362,478
effective HSP length: 69
effective length of database: 2,017,202
effective search space used: 244081442
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -