SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS20056
         (750 letters)

Database: spombe 
           5004 sequences; 2,362,478 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SPAC22A12.15c |bip1|bip|BiP |Schizosaccharomyces pombe|chr 1|||M...   168   8e-43
SPAC13G7.02c |ssa1||heat shock protein Ssa1|Schizosaccharomyces ...   109   3e-25
SPCC1739.13 |ssa2||heat shock protein Ssa2|Schizosaccharomyces p...   109   3e-25
SPBC1709.05 |sks2|hsc1|heat shock protein Sks2|Schizosaccharomyc...    99   8e-22
SPAC664.11 |ssc1|ssp1|Hsp70 chaperone mtHsp70|Schizosaccharomyce...    92   7e-20
SPAC110.04c |pss1|ssp1, SPAP14E8.01c|heat shock protein Pss1|Sch...    49   6e-07
SPAC57A7.12 |||heat shock protein Pdr13 |Schizosaccharomyces pom...    40   5e-04
SPAC1F5.06 |||heat shock protein Lhs1 |Schizosaccharomyces pombe...    31   0.23 
SPAC25B8.04c |||mitochondrial splicing suppressor |Schizosacchar...    29   0.94 
SPAC9.03c |brr2|spp41|U5 snRNP complex subunit Brr2 |Schizosacch...    27   2.2  
SPAC823.11 |||sphingosine-1-phosphate phosphatase |Schizosacchar...    27   2.9  
SPAC22G7.06c |ura1||carbamoyl-phosphate synthase |Schizosaccharo...    26   5.0  
SPBC25H2.13c |cdc20|pol2|DNA polymerase epsilon catalytic subuni...    25   8.7  
SPAPJ760.02c |app1||App1 protein|Schizosaccharomyces pombe|chr 1...    25   8.7  

>SPAC22A12.15c |bip1|bip|BiP |Schizosaccharomyces pombe|chr
           1|||Manual
          Length = 663

 Score =  168 bits (408), Expect = 8e-43
 Identities = 97/222 (43%), Positives = 129/222 (58%), Gaps = 2/222 (0%)
 Frame = +3

Query: 90  VGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMTP-TT 266
           +GIDLGTTYSCV V ++G+VEIIANDQGNR TPSYVAFT+ ERL+G+AAKNQ    P  T
Sbjct: 38  IGIDLGTTYSCVAVMKNGRVEIIANDQGNRITPSYVAFTEDERLVGEAAKNQAPSNPENT 97

Query: 267 QYSMPNVSSDVSSKMLLCKPT*STGLSSCQ*WRQT*DQGSI*G*RQNLFPRGSQFHGAYE 446
            + +  +      +  + K   S          +   + ++ G ++   P         +
Sbjct: 98  IFDIKRLIGRKFDEKTMAKDIKSFPFHIVNDKNRPLVEVNVGGKKKKFTPEEISAMILSK 157

Query: 447 NEGNCRSLSWQNCAECSYHGSAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLD 626
            +    +   +          AYFND+QRQATKDAGTI+GLNV+RI+NEPTAAAIAYGLD
Sbjct: 158 MKQTAEAYLGKPVTHAVVTVPAYFNDAQRQATKDAGTIAGLNVIRIVNEPTAAAIAYGLD 217

Query: 627 KKGTGERNVLIFDLGGGTSTCPSLP-SRRYLRGEIHRGDTHL 749
           K  T E++++++DLGGGT     L             GDTHL
Sbjct: 218 KTDT-EKHIVVYDLGGGTFDVSLLSIDNGVFEVLATSGDTHL 258



 Score = 71.7 bits (168), Expect = 1e-13
 Identities = 31/60 (51%), Positives = 46/60 (76%)
 Frame = +1

Query: 331 EALAFRVVSDGGKPKIKVAYKGEDKTFFPEEVSSMVLTKMKETAEAYLGKTVQNAVITVP 510
           ++  F +V+D  +P ++V   G+ K F PEE+S+M+L+KMK+TAEAYLGK V +AV+TVP
Sbjct: 119 KSFPFHIVNDKNRPLVEVNVGGKKKKFTPEEISAMILSKMKQTAEAYLGKPVTHAVVTVP 178



 Score = 48.4 bits (110), Expect = 1e-06
 Identities = 23/57 (40%), Positives = 35/57 (61%)
 Frame = +2

Query: 254 DPNNTIFDAKRLIGRKFEDATVQADMKHWPFELSVMEANLRSR*HIRVKTKPFSPRK 424
           +P NTIFD KRLIGRKF++ T+  D+K +PF +   +       ++  K K F+P +
Sbjct: 93  NPENTIFDIKRLIGRKFDEKTMAKDIKSFPFHIVNDKNRPLVEVNVGGKKKKFTPEE 149


>SPAC13G7.02c |ssa1||heat shock protein Ssa1|Schizosaccharomyces
           pombe|chr 1|||Manual
          Length = 644

 Score =  109 bits (263), Expect = 3e-25
 Identities = 50/58 (86%), Positives = 54/58 (93%)
 Frame = +3

Query: 87  AVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMTP 260
           ++GIDLGTTYSCVG F + +VEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAM P
Sbjct: 4   SIGIDLGTTYSCVGHFSNNRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNP 61



 Score =  104 bits (250), Expect = 1e-23
 Identities = 55/81 (67%), Positives = 58/81 (71%), Gaps = 1/81 (1%)
 Frame = +3

Query: 510 AYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGTSTC 689
           AYFNDSQRQATKDAG I+GLNVLRIINEPTAAAIAYGLD+    E NVLIFDLGGGT   
Sbjct: 146 AYFNDSQRQATKDAGLIAGLNVLRIINEPTAAAIAYGLDRSNQHETNVLIFDLGGGTFDV 205

Query: 690 PSLP-SRRYLRGEIHRGDTHL 749
             L         +   GDTHL
Sbjct: 206 SLLTIEEGIFEVKATAGDTHL 226



 Score = 77.0 bits (181), Expect = 3e-15
 Identities = 35/56 (62%), Positives = 45/56 (80%)
 Frame = +1

Query: 343 FRVVSDGGKPKIKVAYKGEDKTFFPEEVSSMVLTKMKETAEAYLGKTVQNAVITVP 510
           F+V+   GKP I+V +KGE KTF PEE+SSMVL KM+E+AEA+LG  V +AV+TVP
Sbjct: 90  FKVIEKDGKPLIQVEFKGETKTFTPEEISSMVLLKMRESAEAFLGGKVTDAVVTVP 145



 Score = 65.3 bits (152), Expect = 9e-12
 Identities = 28/57 (49%), Positives = 40/57 (70%)
 Frame = +2

Query: 254 DPNNTIFDAKRLIGRKFEDATVQADMKHWPFELSVMEANLRSR*HIRVKTKPFSPRK 424
           +P+NTIFDAKRLIGR+F D  VQ+DMKHWPF++   +     +   + +TK F+P +
Sbjct: 60  NPHNTIFDAKRLIGRRFNDPEVQSDMKHWPFKVIEKDGKPLIQVEFKGETKTFTPEE 116


>SPCC1739.13 |ssa2||heat shock protein Ssa2|Schizosaccharomyces
           pombe|chr 3|||Manual
          Length = 647

 Score =  109 bits (263), Expect = 3e-25
 Identities = 50/58 (86%), Positives = 54/58 (93%)
 Frame = +3

Query: 87  AVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMTP 260
           ++GIDLGTTYSCVG F + +VEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAM P
Sbjct: 4   SIGIDLGTTYSCVGHFSNNRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNP 61



 Score =  107 bits (258), Expect = 1e-24
 Identities = 56/81 (69%), Positives = 59/81 (72%), Gaps = 1/81 (1%)
 Frame = +3

Query: 510 AYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGTSTC 689
           AYFNDSQRQATKDAG I+GLNVLRIINEPTAAAIAYGLD+   GE NVLIFDLGGGT   
Sbjct: 146 AYFNDSQRQATKDAGLIAGLNVLRIINEPTAAAIAYGLDRSNQGESNVLIFDLGGGTFDV 205

Query: 690 PSLP-SRRYLRGEIHRGDTHL 749
             L         +   GDTHL
Sbjct: 206 SLLTIEEGIFEVKATAGDTHL 226



 Score = 82.6 bits (195), Expect = 5e-17
 Identities = 38/56 (67%), Positives = 46/56 (82%)
 Frame = +1

Query: 343 FRVVSDGGKPKIKVAYKGEDKTFFPEEVSSMVLTKMKETAEAYLGKTVQNAVITVP 510
           F+V+S  GKP ++V YKGE KTF PEE+SSMVL KM+ETAEAYLG  V +AV+TVP
Sbjct: 90  FKVISKDGKPVLQVEYKGETKTFTPEEISSMVLMKMRETAEAYLGGKVTDAVVTVP 145



 Score = 66.5 bits (155), Expect = 4e-12
 Identities = 29/57 (50%), Positives = 41/57 (71%)
 Frame = +2

Query: 254 DPNNTIFDAKRLIGRKFEDATVQADMKHWPFELSVMEANLRSR*HIRVKTKPFSPRK 424
           +P+NTIFDAKRLIGRKF+D  VQ+DMKHWPF++   +     +   + +TK F+P +
Sbjct: 60  NPHNTIFDAKRLIGRKFDDPEVQSDMKHWPFKVISKDGKPVLQVEYKGETKTFTPEE 116


>SPBC1709.05 |sks2|hsc1|heat shock protein Sks2|Schizosaccharomyces
           pombe|chr 2|||Manual
          Length = 613

 Score = 98.7 bits (235), Expect = 8e-22
 Identities = 53/81 (65%), Positives = 59/81 (72%), Gaps = 1/81 (1%)
 Frame = +3

Query: 510 AYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGTSTC 689
           AYF+DSQR ATKDAG I+GLNVLRIINEPTAAAIAYGLD K    +NVLIFDLGGGT   
Sbjct: 150 AYFSDSQRAATKDAGAIAGLNVLRIINEPTAAAIAYGLDAKSDKPKNVLIFDLGGGTFDV 209

Query: 690 PSLPSRRYLRGEI-HRGDTHL 749
             L  +  +   +   GDTHL
Sbjct: 210 SLLKIQGGVFEVLATAGDTHL 230



 Score = 97.9 bits (233), Expect = 1e-21
 Identities = 44/58 (75%), Positives = 50/58 (86%)
 Frame = +3

Query: 87  AVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMTP 260
           A+GIDLGTTYSCV V++   VEII NDQG RTTPS+VAFT+TERL+GDAAKNQ AM P
Sbjct: 8   AIGIDLGTTYSCVAVWETANVEIIPNDQGARTTPSFVAFTETERLVGDAAKNQAAMNP 65



 Score = 66.9 bits (156), Expect = 3e-12
 Identities = 32/56 (57%), Positives = 41/56 (73%)
 Frame = +1

Query: 343 FRVVSDGGKPKIKVAYKGEDKTFFPEEVSSMVLTKMKETAEAYLGKTVQNAVITVP 510
           F+V+ + G P I+V Y GE K F  +E+S+MVLTKMKE +EA L K V+ AVITVP
Sbjct: 94  FKVIDNNGIPTIEVNYLGEKKQFTAQEISAMVLTKMKEISEAKLNKRVEKAVITVP 149



 Score = 56.8 bits (131), Expect = 3e-09
 Identities = 21/33 (63%), Positives = 28/33 (84%)
 Frame = +2

Query: 254 DPNNTIFDAKRLIGRKFEDATVQADMKHWPFEL 352
           +P NT+FDAKRLIGR++ED   Q D+KHWPF++
Sbjct: 64  NPRNTVFDAKRLIGRRYEDPETQKDIKHWPFKV 96


>SPAC664.11 |ssc1|ssp1|Hsp70 chaperone mtHsp70|Schizosaccharomyces
           pombe|chr 1|||Manual
          Length = 674

 Score = 92.3 bits (219), Expect = 7e-20
 Identities = 49/81 (60%), Positives = 56/81 (69%), Gaps = 1/81 (1%)
 Frame = +3

Query: 510 AYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGTSTC 689
           AYFNDSQRQATK AG I+GLNVLR++NEPTAAA+AYGLDKK   +  V +FDLGGGT   
Sbjct: 192 AYFNDSQRQATKAAGAIAGLNVLRVVNEPTAAALAYGLDKK--NDAIVAVFDLGGGTFDI 249

Query: 690 PSLP-SRRYLRGEIHRGDTHL 749
             L  +          GDTHL
Sbjct: 250 SILELNNGVFEVRSTNGDTHL 270



 Score = 70.9 bits (166), Expect = 2e-13
 Identities = 33/66 (50%), Positives = 44/66 (66%), Gaps = 1/66 (1%)
 Frame = +3

Query: 78  KAPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFT-DTERLIGDAAKNQVAM 254
           K P +GIDLGTT SC+ + +    ++IAN +G RTTPS VAFT D ERL+G +AK Q  +
Sbjct: 49  KGPVIGIDLGTTTSCLAIMEGQTPKVIANAEGTRTTPSVVAFTKDGERLVGVSAKRQAVI 108

Query: 255 TPTTQY 272
            P   +
Sbjct: 109 NPENTF 114



 Score = 50.8 bits (116), Expect = 2e-07
 Identities = 20/36 (55%), Positives = 28/36 (77%)
 Frame = +1

Query: 403 KTFFPEEVSSMVLTKMKETAEAYLGKTVQNAVITVP 510
           KT+ P ++   +L+KM+ETA  YLGK V+NAV+TVP
Sbjct: 156 KTYSPSQIGGFILSKMRETASTYLGKDVKNAVVTVP 191



 Score = 40.7 bits (91), Expect = 2e-04
 Identities = 16/33 (48%), Positives = 24/33 (72%)
 Frame = +2

Query: 254 DPNNTIFDAKRLIGRKFEDATVQADMKHWPFEL 352
           +P NT F  KRLIGR+F++  VQ D+K  P+++
Sbjct: 109 NPENTFFATKRLIGRRFKEPEVQRDIKEVPYKI 141


>SPAC110.04c |pss1|ssp1, SPAP14E8.01c|heat shock protein
           Pss1|Schizosaccharomyces pombe|chr 1|||Manual
          Length = 720

 Score = 49.2 bits (112), Expect = 6e-07
 Identities = 20/59 (33%), Positives = 38/59 (64%)
 Frame = +3

Query: 75  AKAPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA 251
           ++   VGID G + + + V ++  +++I N+  NR+TPS V++ +  R +G+AAK+  A
Sbjct: 3   SRTNVVGIDFGNSKTVIAVARNRAIDVIVNEVSNRSTPSLVSYGERSRFLGEAAKSAEA 61



 Score = 49.2 bits (112), Expect = 6e-07
 Identities = 30/78 (38%), Positives = 42/78 (53%), Gaps = 4/78 (5%)
 Frame = +3

Query: 510 AYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGE----RNVLIFDLGGG 677
           A+F D QR+A  +A  I+GLN LR++N+  AAA+ YG+ K    E    R V I D G  
Sbjct: 150 AWFTDIQRRALLEAANIAGLNPLRLMNDNAAAALTYGITKTDLPEPESPRRVAIVDFGHS 209

Query: 678 TSTCPSLPSRRYLRGEIH 731
                S+    + RG+ H
Sbjct: 210 NY---SVSIVEFSRGQFH 224


>SPAC57A7.12 |||heat shock protein Pdr13 |Schizosaccharomyces
           pombe|chr 1|||Manual
          Length = 566

 Score = 39.5 bits (88), Expect = 5e-04
 Identities = 16/53 (30%), Positives = 30/53 (56%)
 Frame = +3

Query: 90  VGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQV 248
           +GI  G   S +   + GK +++AN++GNR  PS +++   +   G  A+ Q+
Sbjct: 27  IGISFGNQNSSIAFNRDGKTDVLANEEGNRQIPSILSYHGDQEYHGVQARGQL 79



 Score = 39.1 bits (87), Expect = 7e-04
 Identities = 19/64 (29%), Positives = 35/64 (54%)
 Frame = +3

Query: 492 CSYHGSAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLG 671
           C      YF D+QR+A + A   +GL VL++I++P A  +A    ++   ++ V++ + G
Sbjct: 166 CVMSVPVYFTDAQRKALESAANEAGLPVLQLIHDPAAVILALMYSEEVLIDKTVVVANFG 225

Query: 672 GGTS 683
              S
Sbjct: 226 ATRS 229



 Score = 27.5 bits (58), Expect = 2.2
 Identities = 13/38 (34%), Positives = 21/38 (55%)
 Frame = +1

Query: 397 EDKTFFPEEVSSMVLTKMKETAEAYLGKTVQNAVITVP 510
           ++K     E S   L ++ E+AE +LG  V   V++VP
Sbjct: 134 KEKILTAHEASVRHLRRLTESAEDFLGTKVNGCVMSVP 171


>SPAC1F5.06 |||heat shock protein Lhs1 |Schizosaccharomyces
           pombe|chr 1|||Manual
          Length = 848

 Score = 30.7 bits (66), Expect = 0.23
 Identities = 21/67 (31%), Positives = 31/67 (46%), Gaps = 1/67 (1%)
 Frame = +3

Query: 90  VGIDLGTTYSCVGVFQHG-KVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMTPTT 266
           + ID GT ++   + + G  +EI+      R   S VAF   ER+ G  A N     P  
Sbjct: 25  LAIDYGTEWTKAALIKPGIPLEIVLTKDTRRKEQSAVAFKGNERIFGVDASNLATRFPA- 83

Query: 267 QYSMPNV 287
            +S+ NV
Sbjct: 84  -HSIRNV 89


>SPAC25B8.04c |||mitochondrial splicing suppressor
           |Schizosaccharomyces pombe|chr 1|||Manual
          Length = 378

 Score = 28.7 bits (61), Expect = 0.94
 Identities = 12/32 (37%), Positives = 18/32 (56%)
 Frame = +1

Query: 82  HPQ*ESIWVPRTLALVSSSTGRWRSSPTTRAT 177
           HP   S W+P    LVS+    W +SP+++ T
Sbjct: 283 HPLYSSSWIPTLHDLVSTRCSVWLTSPSSQRT 314


>SPAC9.03c |brr2|spp41|U5 snRNP complex subunit Brr2
            |Schizosaccharomyces pombe|chr 1|||Manual
          Length = 2176

 Score = 27.5 bits (58), Expect = 2.2
 Identities = 20/88 (22%), Positives = 37/88 (42%)
 Frame = -2

Query: 590  IDDSENVQARDGTCIFCGLSLRVIEVRGTVITAFCTVLPR*ASAVSFIFVSTMELTSSGK 411
            I+DSE+V A   + +   L+  + E      T      P   +   ++ +S  +   + K
Sbjct: 2059 IEDSEDVHANSPSVLIVQLTRELEEDEEVDTTVIAPYFPAQKTEHWWLVISDDKTLLAIK 2118

Query: 410  KVLSSPLYATLILGLPPSLTTRKASASC 327
            K+       T +  +PP++ T K   SC
Sbjct: 2119 KITLGRSLTTKMEFVPPAMGTLKYKLSC 2146


>SPAC823.11 |||sphingosine-1-phosphate phosphatase
           |Schizosaccharomyces pombe|chr 1|||Manual
          Length = 411

 Score = 27.1 bits (57), Expect = 2.9
 Identities = 17/55 (30%), Positives = 27/55 (49%)
 Frame = -1

Query: 168 GRWR*SPPSRAGRHQRKSTWYPDRFLLRVLLPFCIFNQSCYLFLKQLSKRARLLV 4
           G W  SP S +  H   ++++  +F +RVL   C+      L  K  +K+A L V
Sbjct: 276 GTWFASPESLSHLHDNLNSYFLLKFFVRVLFGVCMI-----LIWKSFAKQALLAV 325


>SPAC22G7.06c |ura1||carbamoyl-phosphate synthase |Schizosaccharomyces
            pombe|chr 1|||Manual
          Length = 2244

 Score = 26.2 bits (55), Expect = 5.0
 Identities = 14/45 (31%), Positives = 24/45 (53%)
 Frame = +3

Query: 186  PSYVAFTDTERLIGDAAKNQVAMTPTTQYSMPNVSSDVSSKMLLC 320
            P  +A T  ER++  AAK   A+  T  Y++  ++ D   K++ C
Sbjct: 1252 PQDLAPTTIERIVDAAAKIGEALNITGPYNIQFIAKDNEIKVIEC 1296


>SPBC25H2.13c |cdc20|pol2|DNA polymerase epsilon catalytic subunit a
            Pol2 |Schizosaccharomyces pombe|chr 2|||Manual
          Length = 2199

 Score = 25.4 bits (53), Expect = 8.7
 Identities = 14/30 (46%), Positives = 15/30 (50%)
 Frame = +3

Query: 435  GAYENEGNCRSLSWQNCAECSYHGSAYFND 524
            GAY N   C  +S  N A CS   SA  ND
Sbjct: 1689 GAYSNA--CVDISLSNLALCSILNSALIND 1716


>SPAPJ760.02c |app1||App1 protein|Schizosaccharomyces pombe|chr
           1|||Manual
          Length = 857

 Score = 25.4 bits (53), Expect = 8.7
 Identities = 12/34 (35%), Positives = 17/34 (50%)
 Frame = +3

Query: 198 AFTDTERLIGDAAKNQVAMTPTTQYSMPNVSSDV 299
           AF D  +  G  AK   A  P+T+  + N+S  V
Sbjct: 155 AFYDASQTFGSTAKVAPAPAPSTKTPLANISKPV 188


  Database: spombe
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 2,362,478
  Number of sequences in database:  5004
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 3,365,986
Number of Sequences: 5004
Number of extensions: 73578
Number of successful extensions: 268
Number of sequences better than 10.0: 14
Number of HSP's better than 10.0 without gapping: 238
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 264
length of database: 2,362,478
effective HSP length: 71
effective length of database: 2,007,194
effective search space used: 357280532
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -