SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS20055
         (759 letters)

Database: spombe 
           5004 sequences; 2,362,478 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SPCC1739.13 |ssa2||heat shock protein Ssa2|Schizosaccharomyces p...   155   5e-39
SPAC13G7.02c |ssa1||heat shock protein Ssa1|Schizosaccharomyces ...   152   5e-38
SPAC22A12.15c |bip1|bip|BiP |Schizosaccharomyces pombe|chr 1|||M...   140   3e-34
SPBC1709.05 |sks2|hsc1|heat shock protein Sks2|Schizosaccharomyc...   140   3e-34
SPAC664.11 |ssc1|ssp1|Hsp70 chaperone mtHsp70|Schizosaccharomyce...   132   7e-32
SPAC110.04c |pss1|ssp1, SPAP14E8.01c|heat shock protein Pss1|Sch...    71   2e-13
SPAC57A7.12 |||heat shock protein Pdr13 |Schizosaccharomyces pom...    58   1e-09
SPAC1F5.06 |||heat shock protein Lhs1 |Schizosaccharomyces pombe...    29   0.54 
SPAC823.11 |||sphingosine-1-phosphate phosphatase |Schizosacchar...    29   0.54 
SPAC25B8.04c |||mitochondrial splicing suppressor |Schizosacchar...    29   0.95 
SPAPB1E7.04c |||chitinase |Schizosaccharomyces pombe|chr 1|||Manual    27   2.9  
SPAC3G9.11c |||pyruvate decarboxylase |Schizosaccharomyces pombe...    25   8.9  

>SPCC1739.13 |ssa2||heat shock protein Ssa2|Schizosaccharomyces
           pombe|chr 3|||Manual
          Length = 647

 Score =  155 bits (377), Expect = 5e-39
 Identities = 73/84 (86%), Positives = 78/84 (92%)
 Frame = +1

Query: 508 VPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGTF 687
           VPAYFNDSQRQATKDAG I+GLNVLRIINEPTAAAIAYGLD+   GE NVLIFDLGGGTF
Sbjct: 144 VPAYFNDSQRQATKDAGLIAGLNVLRIINEPTAAAIAYGLDRSNQGESNVLIFDLGGGTF 203

Query: 688 DVSILTIEDGIFEVKSTAGDTHFG 759
           DVS+LTIE+GIFEVK+TAGDTH G
Sbjct: 204 DVSLLTIEEGIFEVKATAGDTHLG 227



 Score =  138 bits (333), Expect = 1e-33
 Identities = 62/87 (71%), Positives = 74/87 (85%)
 Frame = +2

Query: 254 VNPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVSDGGKPKIKVAYKGEDKTFFPEEVS 433
           +NP+NTIFDAKRLIGRKF+D  VQ+DMKHWPF+V+S  GKP ++V YKGE KTF PEE+S
Sbjct: 59  MNPHNTIFDAKRLIGRKFDDPEVQSDMKHWPFKVISKDGKPVLQVEYKGETKTFTPEEIS 118

Query: 434 SMVLTKMKETAEAYLGKTVQNAVITFP 514
           SMVL KM+ETAEAYLG  V +AV+T P
Sbjct: 119 SMVLMKMRETAEAYLGGKVTDAVVTVP 145



 Score =  106 bits (254), Expect = 4e-24
 Identities = 49/58 (84%), Positives = 53/58 (91%)
 Frame = +3

Query: 90  AVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA*TP 263
           ++GIDLGTTYSCVG F + +VEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA  P
Sbjct: 4   SIGIDLGTTYSCVGHFSNNRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNP 61


>SPAC13G7.02c |ssa1||heat shock protein Ssa1|Schizosaccharomyces
           pombe|chr 1|||Manual
          Length = 644

 Score =  152 bits (369), Expect = 5e-38
 Identities = 72/84 (85%), Positives = 77/84 (91%)
 Frame = +1

Query: 508 VPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGTF 687
           VPAYFNDSQRQATKDAG I+GLNVLRIINEPTAAAIAYGLD+    E NVLIFDLGGGTF
Sbjct: 144 VPAYFNDSQRQATKDAGLIAGLNVLRIINEPTAAAIAYGLDRSNQHETNVLIFDLGGGTF 203

Query: 688 DVSILTIEDGIFEVKSTAGDTHFG 759
           DVS+LTIE+GIFEVK+TAGDTH G
Sbjct: 204 DVSLLTIEEGIFEVKATAGDTHLG 227



 Score =  130 bits (314), Expect = 2e-31
 Identities = 58/87 (66%), Positives = 72/87 (82%)
 Frame = +2

Query: 254 VNPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVSDGGKPKIKVAYKGEDKTFFPEEVS 433
           +NP+NTIFDAKRLIGR+F D  VQ+DMKHWPF+V+   GKP I+V +KGE KTF PEE+S
Sbjct: 59  MNPHNTIFDAKRLIGRRFNDPEVQSDMKHWPFKVIEKDGKPLIQVEFKGETKTFTPEEIS 118

Query: 434 SMVLTKMKETAEAYLGKTVQNAVITFP 514
           SMVL KM+E+AEA+LG  V +AV+T P
Sbjct: 119 SMVLLKMRESAEAFLGGKVTDAVVTVP 145



 Score =  106 bits (254), Expect = 4e-24
 Identities = 49/58 (84%), Positives = 53/58 (91%)
 Frame = +3

Query: 90  AVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA*TP 263
           ++GIDLGTTYSCVG F + +VEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA  P
Sbjct: 4   SIGIDLGTTYSCVGHFSNNRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNP 61


>SPAC22A12.15c |bip1|bip|BiP |Schizosaccharomyces pombe|chr
           1|||Manual
          Length = 663

 Score =  140 bits (338), Expect = 3e-34
 Identities = 62/84 (73%), Positives = 79/84 (94%)
 Frame = +1

Query: 508 VPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGTF 687
           VPAYFND+QRQATKDAGTI+GLNV+RI+NEPTAAAIAYGLDK  T E++++++DLGGGTF
Sbjct: 177 VPAYFNDAQRQATKDAGTIAGLNVIRIVNEPTAAAIAYGLDKTDT-EKHIVVYDLGGGTF 235

Query: 688 DVSILTIEDGIFEVKSTAGDTHFG 759
           DVS+L+I++G+FEV +T+GDTH G
Sbjct: 236 DVSLLSIDNGVFEVLATSGDTHLG 259



 Score =  111 bits (267), Expect = 1e-25
 Identities = 49/86 (56%), Positives = 67/86 (77%)
 Frame = +2

Query: 257 NPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVSDGGKPKIKVAYKGEDKTFFPEEVSS 436
           NP NTIFD KRLIGRKF++ T+  D+K +PF +V+D  +P ++V   G+ K F PEE+S+
Sbjct: 93  NPENTIFDIKRLIGRKFDEKTMAKDIKSFPFHIVNDKNRPLVEVNVGGKKKKFTPEEISA 152

Query: 437 MVLTKMKETAEAYLGKTVQNAVITFP 514
           M+L+KMK+TAEAYLGK V +AV+T P
Sbjct: 153 MILSKMKQTAEAYLGKPVTHAVVTVP 178



 Score = 94.7 bits (225), Expect = 1e-20
 Identities = 42/57 (73%), Positives = 49/57 (85%)
 Frame = +3

Query: 93  VGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA*TP 263
           +GIDLGTTYSCV V ++G+VEIIANDQGNR TPSYVAFT+ ERL+G+AAKNQ    P
Sbjct: 38  IGIDLGTTYSCVAVMKNGRVEIIANDQGNRITPSYVAFTEDERLVGEAAKNQAPSNP 94


>SPBC1709.05 |sks2|hsc1|heat shock protein Sks2|Schizosaccharomyces
           pombe|chr 2|||Manual
          Length = 613

 Score =  140 bits (338), Expect = 3e-34
 Identities = 66/84 (78%), Positives = 73/84 (86%)
 Frame = +1

Query: 508 VPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGTF 687
           VPAYF+DSQR ATKDAG I+GLNVLRIINEPTAAAIAYGLD K    +NVLIFDLGGGTF
Sbjct: 148 VPAYFSDSQRAATKDAGAIAGLNVLRIINEPTAAAIAYGLDAKSDKPKNVLIFDLGGGTF 207

Query: 688 DVSILTIEDGIFEVKSTAGDTHFG 759
           DVS+L I+ G+FEV +TAGDTH G
Sbjct: 208 DVSLLKIQGGVFEVLATAGDTHLG 231



 Score =  116 bits (279), Expect = 4e-27
 Identities = 52/87 (59%), Positives = 66/87 (75%)
 Frame = +2

Query: 254 VNPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVSDGGKPKIKVAYKGEDKTFFPEEVS 433
           +NP NT+FDAKRLIGR++ED   Q D+KHWPF+V+ + G P I+V Y GE K F  +E+S
Sbjct: 63  MNPRNTVFDAKRLIGRRYEDPETQKDIKHWPFKVIDNNGIPTIEVNYLGEKKQFTAQEIS 122

Query: 434 SMVLTKMKETAEAYLGKTVQNAVITFP 514
           +MVLTKMKE +EA L K V+ AVIT P
Sbjct: 123 AMVLTKMKEISEAKLNKRVEKAVITVP 149



 Score = 94.3 bits (224), Expect = 2e-20
 Identities = 43/58 (74%), Positives = 49/58 (84%)
 Frame = +3

Query: 90  AVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA*TP 263
           A+GIDLGTTYSCV V++   VEII NDQG RTTPS+VAFT+TERL+GDAAKNQ A  P
Sbjct: 8   AIGIDLGTTYSCVAVWETANVEIIPNDQGARTTPSFVAFTETERLVGDAAKNQAAMNP 65


>SPAC664.11 |ssc1|ssp1|Hsp70 chaperone mtHsp70|Schizosaccharomyces
           pombe|chr 1|||Manual
          Length = 674

 Score =  132 bits (318), Expect = 7e-32
 Identities = 61/84 (72%), Positives = 72/84 (85%)
 Frame = +1

Query: 508 VPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGTF 687
           VPAYFNDSQRQATK AG I+GLNVLR++NEPTAAA+AYGLDKK   +  V +FDLGGGTF
Sbjct: 190 VPAYFNDSQRQATKAAGAIAGLNVLRVVNEPTAAALAYGLDKK--NDAIVAVFDLGGGTF 247

Query: 688 DVSILTIEDGIFEVKSTAGDTHFG 759
           D+SIL + +G+FEV+ST GDTH G
Sbjct: 248 DISILELNNGVFEVRSTNGDTHLG 271



 Score = 81.4 bits (192), Expect = 1e-16
 Identities = 37/87 (42%), Positives = 54/87 (62%)
 Frame = +2

Query: 254 VNPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVSDGGKPKIKVAYKGEDKTFFPEEVS 433
           +NP NT F  KRLIGR+F++  VQ D+K  P+++V            +   KT+ P ++ 
Sbjct: 108 INPENTFFATKRLIGRRFKEPEVQRDIKEVPYKIVEHSNGD---AWLEARGKTYSPSQIG 164

Query: 434 SMVLTKMKETAEAYLGKTVQNAVITFP 514
             +L+KM+ETA  YLGK V+NAV+T P
Sbjct: 165 GFILSKMRETASTYLGKDVKNAVVTVP 191



 Score = 68.9 bits (161), Expect = 7e-13
 Identities = 33/66 (50%), Positives = 43/66 (65%), Gaps = 1/66 (1%)
 Frame = +3

Query: 81  KAPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFT-DTERLIGDAAKNQVA* 257
           K P +GIDLGTT SC+ + +    ++IAN +G RTTPS VAFT D ERL+G +AK Q   
Sbjct: 49  KGPVIGIDLGTTTSCLAIMEGQTPKVIANAEGTRTTPSVVAFTKDGERLVGVSAKRQAVI 108

Query: 258 TPTTQY 275
            P   +
Sbjct: 109 NPENTF 114


>SPAC110.04c |pss1|ssp1, SPAP14E8.01c|heat shock protein
           Pss1|Schizosaccharomyces pombe|chr 1|||Manual
          Length = 720

 Score = 70.9 bits (166), Expect = 2e-13
 Identities = 37/88 (42%), Positives = 51/88 (57%), Gaps = 4/88 (4%)
 Frame = +1

Query: 508 VPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGE----RNVLIFDLG 675
           +PA+F D QR+A  +A  I+GLN LR++N+  AAA+ YG+ K    E    R V I D G
Sbjct: 148 IPAWFTDIQRRALLEAANIAGLNPLRLMNDNAAAALTYGITKTDLPEPESPRRVAIVDFG 207

Query: 676 GGTFDVSILTIEDGIFEVKSTAGDTHFG 759
              + VSI+    G F +KST  D + G
Sbjct: 208 HSNYSVSIVEFSRGQFHIKSTVCDRNLG 235



 Score = 49.2 bits (112), Expect = 6e-07
 Identities = 20/59 (33%), Positives = 38/59 (64%)
 Frame = +3

Query: 78  AKAPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA 254
           ++   VGID G + + + V ++  +++I N+  NR+TPS V++ +  R +G+AAK+  A
Sbjct: 3   SRTNVVGIDFGNSKTVIAVARNRAIDVIVNEVSNRSTPSLVSYGERSRFLGEAAKSAEA 61



 Score = 39.9 bits (89), Expect = 4e-04
 Identities = 26/87 (29%), Positives = 42/87 (48%), Gaps = 1/87 (1%)
 Frame = +2

Query: 257 NPNNTIFDAKRLIGRKFEDATVQ-ADMKHWPFEVVSDGGKPKIKVAYKGEDKTFFPEEVS 433
           N  NT+   KRL GR ++D  ++  +      ++    G    KV Y  E+  F   ++ 
Sbjct: 63  NFRNTVGSLKRLAGRTYDDPEIKDIESNFISAKLTEVDGFVGAKVQYLNEETAFSNIQLI 122

Query: 434 SMVLTKMKETAEAYLGKTVQNAVITFP 514
           +   TK+K  AEA L  +V + VI+ P
Sbjct: 123 AAYFTKIKAIAEAELIGSVSDVVISIP 149


>SPAC57A7.12 |||heat shock protein Pdr13 |Schizosaccharomyces
           pombe|chr 1|||Manual
          Length = 566

 Score = 58.0 bits (134), Expect = 1e-09
 Identities = 25/88 (28%), Positives = 52/88 (59%)
 Frame = +1

Query: 496 CSYHVPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLG 675
           C   VP YF D+QR+A + A   +GL VL++I++P A  +A    ++   ++ V++ + G
Sbjct: 166 CVMSVPVYFTDAQRKALESAANEAGLPVLQLIHDPAAVILALMYSEEVLIDKTVVVANFG 225

Query: 676 GGTFDVSILTIEDGIFEVKSTAGDTHFG 759
               +VS+++++ G+  + ++  D + G
Sbjct: 226 ATRSEVSVVSVKGGLMTILASVHDENLG 253



 Score = 39.5 bits (88), Expect = 5e-04
 Identities = 16/53 (30%), Positives = 30/53 (56%)
 Frame = +3

Query: 93  VGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQV 251
           +GI  G   S +   + GK +++AN++GNR  PS +++   +   G  A+ Q+
Sbjct: 27  IGISFGNQNSSIAFNRDGKTDVLANEEGNRQIPSILSYHGDQEYHGVQARGQL 79


>SPAC1F5.06 |||heat shock protein Lhs1 |Schizosaccharomyces
           pombe|chr 1|||Manual
          Length = 848

 Score = 29.5 bits (63), Expect = 0.54
 Identities = 21/67 (31%), Positives = 31/67 (46%), Gaps = 1/67 (1%)
 Frame = +3

Query: 93  VGIDLGTTYSCVGVFQHG-KVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA*TPTT 269
           + ID GT ++   + + G  +EI+      R   S VAF   ER+ G  A N     P  
Sbjct: 25  LAIDYGTEWTKAALIKPGIPLEIVLTKDTRRKEQSAVAFKGNERIFGVDASNLATRFPA- 83

Query: 270 QYSMPNV 290
            +S+ NV
Sbjct: 84  -HSIRNV 89


>SPAC823.11 |||sphingosine-1-phosphate phosphatase
           |Schizosaccharomyces pombe|chr 1|||Manual
          Length = 411

 Score = 29.5 bits (63), Expect = 0.54
 Identities = 17/57 (29%), Positives = 29/57 (50%)
 Frame = -1

Query: 171 GRWR*SPPSRAGRHQRKSTWYPDRFLLRVLLPFCIFNQSCYLFLKQLSKRARLTLVP 1
           G W  SP S +  H   ++++  +F +RVL   C+      L  K  +K+A L ++P
Sbjct: 276 GTWFASPESLSHLHDNLNSYFLLKFFVRVLFGVCMI-----LIWKSFAKQALLAVLP 327


>SPAC25B8.04c |||mitochondrial splicing suppressor
           |Schizosaccharomyces pombe|chr 1|||Manual
          Length = 378

 Score = 28.7 bits (61), Expect = 0.95
 Identities = 12/32 (37%), Positives = 18/32 (56%)
 Frame = +1

Query: 85  HPQ*ESIWVPRTLALVSSSTGRWRSSPTTRAT 180
           HP   S W+P    LVS+    W +SP+++ T
Sbjct: 283 HPLYSSSWIPTLHDLVSTRCSVWLTSPSSQRT 314


>SPAPB1E7.04c |||chitinase |Schizosaccharomyces pombe|chr 1|||Manual
          Length = 1236

 Score = 27.1 bits (57), Expect = 2.9
 Identities = 28/126 (22%), Positives = 52/126 (41%)
 Frame = -1

Query: 681 TAAEVKDKYISFSSTLFVKTVSNRSSSRFIDDSENVQARDGTCIFCGLSLRVIEVRGNVI 502
           +++ +   + S SS L   T S  S+S  I  S        +  F   S        + I
Sbjct: 565 SSSSIPSTFSSVSSILSSSTSSPSSTSLSISSSST------SSTFSSASTSSPSSISSSI 618

Query: 501 TAFCTVLPR*ASAVSFIFVSTMELTSSGKKVLSSPLYATLILGLPPSLTTSKGQCFMSAC 322
           ++  T+L     + S + +S+  + S    +LSS +     + +  SL+T       S+ 
Sbjct: 619 SSSSTILSSPTPSTSSLMISSSSIISGSSSILSSSIST---IPISSSLSTYSSSVIPSSS 675

Query: 321 TVASSN 304
           T+ SS+
Sbjct: 676 TLVSSS 681


>SPAC3G9.11c |||pyruvate decarboxylase |Schizosaccharomyces
           pombe|chr 1|||Manual
          Length = 570

 Score = 25.4 bits (53), Expect = 8.9
 Identities = 17/51 (33%), Positives = 28/51 (54%), Gaps = 1/51 (1%)
 Frame = -2

Query: 263 WGSRHLVLGGISDETLGVCERNIRRSGPVALVVGD-DLHLPVLEDTNARVR 114
           WGS    +G +   TLG+ + +      + L+VGD  LHL V ++ +A +R
Sbjct: 418 WGSIGWSVGAMFGATLGIKDSDAPHRRSI-LIVGDGSLHLTV-QEISATIR 466


  Database: spombe
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 2,362,478
  Number of sequences in database:  5004
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 3,369,594
Number of Sequences: 5004
Number of extensions: 73739
Number of successful extensions: 277
Number of sequences better than 10.0: 12
Number of HSP's better than 10.0 without gapping: 248
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 273
length of database: 2,362,478
effective HSP length: 71
effective length of database: 2,007,194
effective search space used: 363302114
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -