SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS20054
         (677 letters)

Database: spombe 
           5004 sequences; 2,362,478 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SPCC338.13 |cog4||Golgi transport complex subunit Cog4 |Schizosa...    27   2.5  
SPBC3B8.06 |||conserved fungal protein|Schizosaccharomyces pombe...    27   3.3  
SPBC2F12.15c |||palmitoyltransferase|Schizosaccharomyces pombe|c...    26   5.8  
SPAC1F3.06c |spo15||sporulation protein Spo15|Schizosaccharomyce...    26   5.8  
SPAC19A8.01c |sec73|sec7c, SPAC23H3.01|guanyl-nucleotide exchang...    25   7.6  
SPBC1709.01 |chs2|SPBC1734.17|chitin synthase homolog Chs2|Schiz...    25   7.6  

>SPCC338.13 |cog4||Golgi transport complex subunit Cog4
           |Schizosaccharomyces pombe|chr 3|||Manual
          Length = 738

 Score = 27.1 bits (57), Expect = 2.5
 Identities = 15/45 (33%), Positives = 25/45 (55%)
 Frame = -1

Query: 590 VDNMLIFDRFYQMIIMHVLISNVAIVYGICEFEQYIPVQFLHGIL 456
           +DN++     Y+ I++H  + N A V    E E+ + +Q LH IL
Sbjct: 295 IDNLVSSIASYKYILLHAKLKNRAFVSDQKELER-VSLQTLHPIL 338


>SPBC3B8.06 |||conserved fungal protein|Schizosaccharomyces
           pombe|chr 2|||Manual
          Length = 511

 Score = 26.6 bits (56), Expect = 3.3
 Identities = 14/43 (32%), Positives = 22/43 (51%)
 Frame = -1

Query: 584 NMLIFDRFYQMIIMHVLISNVAIVYGICEFEQYIPVQFLHGIL 456
           N  +      MII +V I    IV  + + + +IPVQ ++ IL
Sbjct: 26  NKFLMAHIICMIIAYVFILPAGIVLAMAKSKAHIPVQIVYVIL 68


>SPBC2F12.15c |||palmitoyltransferase|Schizosaccharomyces pombe|chr
           2|||Manual
          Length = 329

 Score = 25.8 bits (54), Expect = 5.8
 Identities = 13/45 (28%), Positives = 20/45 (44%)
 Frame = -2

Query: 499 NSNSIFLYNFYMVFYKVC*NYRFVVILTTLWRIP*RHNGLMYLIF 365
           N    FL  FY+  Y +C  Y   V +T  +     +   +YL+F
Sbjct: 138 NHKFFFLECFYLNLYSICVLYSTFVAITKTFTAEGANISAIYLVF 182


>SPAC1F3.06c |spo15||sporulation protein Spo15|Schizosaccharomyces
            pombe|chr 1|||Manual
          Length = 1957

 Score = 25.8 bits (54), Expect = 5.8
 Identities = 16/56 (28%), Positives = 29/56 (51%)
 Frame = +2

Query: 152  QDEFDEKVQCKVLDCDSISQVKSKILDALFKNTPFHSDLLSMKLISSGVMVEVDML 319
            Q+E     +  +    +I+ VKSK+ + L K++   +D+  +K   S V VE + L
Sbjct: 954  QEEISNLKEENMSQSQAITSVKSKLDETLSKSSKLEADIEHLKNKVSEVEVERNAL 1009


>SPAC19A8.01c |sec73|sec7c, SPAC23H3.01|guanyl-nucleotide exchange
           factor Sec73 |Schizosaccharomyces pombe|chr 1|||Manual
          Length = 1082

 Score = 25.4 bits (53), Expect = 7.6
 Identities = 11/19 (57%), Positives = 14/19 (73%)
 Frame = +3

Query: 351 IKWMAKIKYISPLWR*GIR 407
           I+W+AKI YIS L   G+R
Sbjct: 760 IEWVAKINYISTLRTAGLR 778


>SPBC1709.01 |chs2|SPBC1734.17|chitin synthase homolog
           Chs2|Schizosaccharomyces pombe|chr 2|||Manual
          Length = 926

 Score = 25.4 bits (53), Expect = 7.6
 Identities = 10/29 (34%), Positives = 17/29 (58%)
 Frame = -2

Query: 532 SVMSLLYTVYVNSNSIFLYNFYMVFYKVC 446
           +V SL++ +    N   + NF++ FY VC
Sbjct: 595 TVQSLVFAIEKLVNFFSMANFFLAFYFVC 623


  Database: spombe
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 2,362,478
  Number of sequences in database:  5004
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 2,635,453
Number of Sequences: 5004
Number of extensions: 51803
Number of successful extensions: 160
Number of sequences better than 10.0: 6
Number of HSP's better than 10.0 without gapping: 154
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 160
length of database: 2,362,478
effective HSP length: 70
effective length of database: 2,012,198
effective search space used: 311890690
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -