SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS20052
         (684 letters)

Database: spombe 
           5004 sequences; 2,362,478 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SPAC23C4.09c |||DNA-binding TFAR19-related protein|Schizosacchar...    61   1e-10
SPBC649.03 |rhp14||XP-A family homolog Rhp14|Schizosaccharomyces...    25   7.7  
SPBC1198.04c |zas1||zinc finger protein Zas1|Schizosaccharomyces...    25   7.7  

>SPAC23C4.09c |||DNA-binding TFAR19-related
           protein|Schizosaccharomyces pombe|chr 1|||Manual
          Length = 131

 Score = 61.3 bits (142), Expect = 1e-10
 Identities = 32/75 (42%), Positives = 45/75 (60%)
 Frame = +3

Query: 261 ARARLNTIKLGRPEKAAMIENMICRMAQMGQIQCKITEPDLIQILESFNQQMPKSQSTVK 440
           AR RL  I L R ++A  +E ++ RMA+ GQI  KI+EP+LI++LE  + ++ K   T  
Sbjct: 57  ARDRLRRIALVRKDRAEAVEELLLRMAKTGQISHKISEPELIELLEKISGEVSKRNETKI 116

Query: 441 FDRRRAALDSDDEDL 485
              RR   D DD DL
Sbjct: 117 VINRRVQDDEDDWDL 131


>SPBC649.03 |rhp14||XP-A family homolog Rhp14|Schizosaccharomyces
           pombe|chr 2|||Manual
          Length = 289

 Score = 25.4 bits (53), Expect = 7.7
 Identities = 10/20 (50%), Positives = 12/20 (60%)
 Frame = +1

Query: 58  VNCDPEKTINCFKMDDPELD 117
           +N DPE    CF+ D  ELD
Sbjct: 106 LNLDPETAPKCFECDSIELD 125


>SPBC1198.04c |zas1||zinc finger protein Zas1|Schizosaccharomyces
           pombe|chr 2|||Manual
          Length = 897

 Score = 25.4 bits (53), Expect = 7.7
 Identities = 14/41 (34%), Positives = 20/41 (48%)
 Frame = -2

Query: 464 QCSPSSVKLNGALRFGHLLIKGFQNLY*IRFSYFTLNLTHL 342
           +C  S    N  L FGH  +K  ++LY +   Y    LT+L
Sbjct: 695 RCYYSIFLNNNILPFGHPFVKECRSLYNLACIYSKTRLTYL 735


  Database: spombe
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 2,362,478
  Number of sequences in database:  5004
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 2,446,690
Number of Sequences: 5004
Number of extensions: 44851
Number of successful extensions: 91
Number of sequences better than 10.0: 3
Number of HSP's better than 10.0 without gapping: 87
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 91
length of database: 2,362,478
effective HSP length: 70
effective length of database: 2,012,198
effective search space used: 315915086
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -