SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS20051
         (781 letters)

Database: spombe 
           5004 sequences; 2,362,478 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SPCP31B10.07 |eft202||translation elongation factor 2 |Schizosac...   102   7e-23
SPAC513.01c |eft201|eft2-1, etf2, SPAPYUK71.04c|translation elon...   102   7e-23
SPCC553.08c |||GTPase Ria1 |Schizosaccharomyces pombe|chr 3|||Ma...    74   3e-14
SPBC1306.01c ||SPBC409.22c|translation elongation factor G|Schiz...    56   4e-09
SPAC1B3.04c |||mitochondrial GTPase Guf1 |Schizosaccharomyces po...    45   1e-05
SPBC660.10 |||translation elongation factor G|Schizosaccharomyce...    44   3e-05
SPBC215.12 |cwf10|spef2, snu114|GTPase Cwf10 |Schizosaccharomyce...    39   7e-04
SPAC23A1.10 |ef1a-b||translation elongation factor EF-1 alpha Ef...    34   0.026
SPCC794.09c |ef1a-a||translation elongation factor EF-1 alpha Ef...    34   0.026
SPBC839.15c |ef1a-c||translation elongation factor EF-1 alpha Ef...    34   0.026
SPBC9B6.04c |tuf1||mitochondrial translation elongation factor E...    30   0.32 
SPAC19G12.02c |pms1||MutL family mismatch-repair protein Pms1|Sc...    28   1.7  
SPBC30B4.01c |wsc1|SPBC3D6.14c|transmembrane receptor Wsc1 |Schi...    28   1.7  
SPBC1271.15c |||translation initiation factor IF-2Mt|Schizosacch...    28   1.7  
SPCC23B6.04c |||sec14 cytosolic factor family|Schizosaccharomyce...    27   4.0  
SPCC584.04 |sup35|erf3|translation release factor eRF3 |Schizosa...    26   5.3  
SPBC839.07 |ibp1||itty bitty phosphatase Ibp1|Schizosaccharomyce...    26   7.0  
SPBC25H2.15 |||programmed cell death protein homolog|Schizosacch...    26   7.0  
SPBC21D10.05c |ucp3|soc2|GTPase activating protein Ucp3 |Schizos...    25   9.2  
SPCC1322.10 |||conserved fungal protein|Schizosaccharomyces pomb...    25   9.2  
SPAC25G10.02 |cce1|ydc2|mitochondrial cruciform cutting endonucl...    25   9.2  
SPBC19F5.03 |||inositol polyphosphate phosphatase |Schizosacchar...    25   9.2  
SPCC1235.05c |fft2||fun thirty related protein Fft2|Schizosaccha...    25   9.2  
SPAP14E8.02 |||transcription factor |Schizosaccharomyces pombe|c...    25   9.2  

>SPCP31B10.07 |eft202||translation elongation factor 2
           |Schizosaccharomyces pombe|chr 3|||Manual
          Length = 842

 Score =  102 bits (244), Expect = 7e-23
 Identities = 47/66 (71%), Positives = 55/66 (83%)
 Frame = +1

Query: 58  MVNFTVDEIRGMMDKKRNIRNMSVIAHVDHGKSTLTDSLVSKAGIIAGARAGETRFTDTR 237
           MV FT +E+R +M K  N+RNMSVIAHVDHGKSTLTDSLV KAGII+ A+AG+ RF DTR
Sbjct: 1   MVAFTPEEVRNLMGKPSNVRNMSVIAHVDHGKSTLTDSLVQKAGIISAAKAGDARFMDTR 60

Query: 238 KDEQDR 255
            DEQ+R
Sbjct: 61  ADEQER 66



 Score = 91.1 bits (216), Expect = 2e-19
 Identities = 50/85 (58%), Positives = 60/85 (70%), Gaps = 1/85 (1%)
 Frame = +3

Query: 258 ITIKSTAISMFFELEEKDLVFITNPDQREKSE-KGFLINLIDSPGHVDFSSEVTAALRVT 434
           +TIKSTAIS+F E+ + D+      D +E ++   FL+NLIDSPGHVDFSSEVTAALRVT
Sbjct: 68  VTIKSTAISLFAEMTDDDM-----KDMKEPADGTDFLVNLIDSPGHVDFSSEVTAALRVT 122

Query: 435 DGALXXXXXXXXXXXQTETVLRQAM 509
           DGAL           QTETVLRQA+
Sbjct: 123 DGALVVVDTIEGVCVQTETVLRQAL 147



 Score = 90.2 bits (214), Expect = 3e-19
 Identities = 41/84 (48%), Positives = 57/84 (67%)
 Frame = +2

Query: 512 ERIKPILFMNKMDRXXXXXXXXXXXXYQTFQRIVENVNVIIATYNDDGGPMGEVRVDPSK 691
           ERI+P++ +NK+DR            YQ F R+VE+VNV+I+TY D    +G+ +V P K
Sbjct: 149 ERIRPVVVVNKVDRALLELQISQEELYQNFARVVESVNVVISTYYDK--VLGDCQVFPDK 206

Query: 692 GSVGFGSGLHGWAFTLKQFSEMYA 763
           G+V F SGLHGWAFT++QF+  YA
Sbjct: 207 GTVAFASGLHGWAFTVRQFANRYA 230


>SPAC513.01c |eft201|eft2-1, etf2, SPAPYUK71.04c|translation
           elongation factor 2 |Schizosaccharomyces pombe|chr
           1|||Manual
          Length = 842

 Score =  102 bits (244), Expect = 7e-23
 Identities = 47/66 (71%), Positives = 55/66 (83%)
 Frame = +1

Query: 58  MVNFTVDEIRGMMDKKRNIRNMSVIAHVDHGKSTLTDSLVSKAGIIAGARAGETRFTDTR 237
           MV FT +E+R +M K  N+RNMSVIAHVDHGKSTLTDSLV KAGII+ A+AG+ RF DTR
Sbjct: 1   MVAFTPEEVRNLMGKPSNVRNMSVIAHVDHGKSTLTDSLVQKAGIISAAKAGDARFMDTR 60

Query: 238 KDEQDR 255
            DEQ+R
Sbjct: 61  ADEQER 66



 Score = 91.1 bits (216), Expect = 2e-19
 Identities = 50/85 (58%), Positives = 60/85 (70%), Gaps = 1/85 (1%)
 Frame = +3

Query: 258 ITIKSTAISMFFELEEKDLVFITNPDQREKSE-KGFLINLIDSPGHVDFSSEVTAALRVT 434
           +TIKSTAIS+F E+ + D+      D +E ++   FL+NLIDSPGHVDFSSEVTAALRVT
Sbjct: 68  VTIKSTAISLFAEMTDDDM-----KDMKEPADGTDFLVNLIDSPGHVDFSSEVTAALRVT 122

Query: 435 DGALXXXXXXXXXXXQTETVLRQAM 509
           DGAL           QTETVLRQA+
Sbjct: 123 DGALVVVDTIEGVCVQTETVLRQAL 147



 Score = 90.2 bits (214), Expect = 3e-19
 Identities = 41/84 (48%), Positives = 57/84 (67%)
 Frame = +2

Query: 512 ERIKPILFMNKMDRXXXXXXXXXXXXYQTFQRIVENVNVIIATYNDDGGPMGEVRVDPSK 691
           ERI+P++ +NK+DR            YQ F R+VE+VNV+I+TY D    +G+ +V P K
Sbjct: 149 ERIRPVVVVNKVDRALLELQISQEELYQNFARVVESVNVVISTYYDK--VLGDCQVFPDK 206

Query: 692 GSVGFGSGLHGWAFTLKQFSEMYA 763
           G+V F SGLHGWAFT++QF+  YA
Sbjct: 207 GTVAFASGLHGWAFTVRQFANRYA 230


>SPCC553.08c |||GTPase Ria1 |Schizosaccharomyces pombe|chr
           3|||Manual
          Length = 1000

 Score = 73.7 bits (173), Expect = 3e-14
 Identities = 43/83 (51%), Positives = 56/83 (67%)
 Frame = +3

Query: 258 ITIKSTAISMFFELEEKDLVFITNPDQREKSEKGFLINLIDSPGHVDFSSEVTAALRVTD 437
           IT+KS+AIS+FF++       I+  D++ + EK +LINLIDSPGHVDFSSEV++A R+ D
Sbjct: 68  ITMKSSAISLFFKV-------ISQNDEK-RVEKDYLINLIDSPGHVDFSSEVSSASRLCD 119

Query: 438 GALXXXXXXXXXXXQTETVLRQA 506
           GA            QT TVLRQA
Sbjct: 120 GAFVLVDAVEGVCSQTITVLRQA 142



 Score = 63.3 bits (147), Expect = 4e-11
 Identities = 28/60 (46%), Positives = 41/60 (68%)
 Frame = +1

Query: 76  DEIRGMMDKKRNIRNMSVIAHVDHGKSTLTDSLVSKAGIIAGARAGETRFTDTRKDEQDR 255
           +++  +   + NIRN +++AHVDHGK+TL DSL++  GII+   AG  RF D R+DE  R
Sbjct: 7   EKLVSLQKNQENIRNFTLLAHVDHGKTTLADSLLASNGIISSKLAGTVRFLDFREDEITR 66



 Score = 54.0 bits (124), Expect = 2e-08
 Identities = 34/95 (35%), Positives = 45/95 (47%), Gaps = 10/95 (10%)
 Frame = +2

Query: 506 YAERIKPILFMNKMDRXXXXXXXXXXXXYQTFQRIVENVNVIIATY----------NDDG 655
           + +RIK IL +NKMDR            +    R+VE VN +I T+          ND+ 
Sbjct: 143 WIDRIKVILVINKMDRLITELKLSPIEAHYHLLRLVEQVNAVIGTFYTGELMQLADNDEV 202

Query: 656 GPMGEVRVDPSKGSVGFGSGLHGWAFTLKQFSEMY 760
                +   P +G+V F S   GWAF L QFSE Y
Sbjct: 203 ISDEGIYFAPEQGNVVFASAYDGWAFCLDQFSEFY 237


>SPBC1306.01c ||SPBC409.22c|translation elongation factor
           G|Schizosaccharomyces pombe|chr 2|||Manual
          Length = 770

 Score = 56.4 bits (130), Expect = 4e-09
 Identities = 34/82 (41%), Positives = 44/82 (53%)
 Frame = +3

Query: 258 ITIKSTAISMFFELEEKDLVFITNPDQREKSEKGFLINLIDSPGHVDFSSEVTAALRVTD 437
           ITI+S A    +E     +    N  Q+   EK + IN+ID+PGH+DF+ EV  ALRV D
Sbjct: 113 ITIQSAATHCTWERTVDQIE--ANEKQKTDFEKSYNINIIDTPGHIDFTIEVERALRVLD 170

Query: 438 GALXXXXXXXXXXXQTETVLRQ 503
           GA+           QT TV RQ
Sbjct: 171 GAVLVLCAVSGVQSQTITVDRQ 192



 Score = 35.1 bits (77), Expect = 0.011
 Identities = 18/46 (39%), Positives = 26/46 (56%), Gaps = 2/46 (4%)
 Frame = +1

Query: 64  NFTVDEIRGMMDKKR--NIRNMSVIAHVDHGKSTLTDSLVSKAGII 195
           N  + E     DKKR   IRN+ + AH+D GK+T T+ ++   G I
Sbjct: 41  NLNIQEQLNDNDKKRLKQIRNIGISAHIDSGKTTFTERVLYYTGRI 86


>SPAC1B3.04c |||mitochondrial GTPase Guf1 |Schizosaccharomyces
           pombe|chr 1|||Manual
          Length = 646

 Score = 45.2 bits (102), Expect = 1e-05
 Identities = 25/70 (35%), Positives = 40/70 (57%)
 Frame = +1

Query: 82  IRGMMDKKRNIRNMSVIAHVDHGKSTLTDSLVSKAGIIAGARAGETRFTDTRKDEQDRAS 261
           +RG+   +  +RN +VIAH+DHGKSTL+D ++   G+I        +F D  K E +R  
Sbjct: 50  VRGIPQNR--VRNWAVIAHIDHGKSTLSDCILKLTGVI-NEHNFRNQFLD--KLEVERRR 104

Query: 262 PLNLRPSLCS 291
            + ++   CS
Sbjct: 105 GITVKAQTCS 114



 Score = 39.1 bits (87), Expect = 7e-04
 Identities = 15/31 (48%), Positives = 23/31 (74%)
 Frame = +3

Query: 354 KGFLINLIDSPGHVDFSSEVTAALRVTDGAL 446
           + +L+NLID+PGHVDF +EV  +L   +G +
Sbjct: 122 QSYLLNLIDTPGHVDFRAEVMHSLAACEGCI 152


>SPBC660.10 |||translation elongation factor G|Schizosaccharomyces
           pombe|chr 2|||Manual
          Length = 813

 Score = 43.6 bits (98), Expect = 3e-05
 Identities = 21/47 (44%), Positives = 28/47 (59%)
 Frame = +3

Query: 366 INLIDSPGHVDFSSEVTAALRVTDGALXXXXXXXXXXXQTETVLRQA 506
           INLID+PGH DF+ EV  ++ V DGA+           QT+ V +QA
Sbjct: 95  INLIDTPGHADFTFEVERSVAVLDGAVAIIDGSAGVEAQTKVVWKQA 141



 Score = 34.7 bits (76), Expect = 0.015
 Identities = 13/27 (48%), Positives = 21/27 (77%)
 Frame = +1

Query: 109 NIRNMSVIAHVDHGKSTLTDSLVSKAG 189
           +IRN+ +IAH+D GK+TLT+ ++   G
Sbjct: 27  SIRNVGIIAHIDAGKTTLTEKMLYYGG 53


>SPBC215.12 |cwf10|spef2, snu114|GTPase Cwf10 |Schizosaccharomyces
           pombe|chr 2|||Manual
          Length = 983

 Score = 39.1 bits (87), Expect = 7e-04
 Identities = 17/52 (32%), Positives = 26/52 (50%)
 Frame = +3

Query: 354 KGFLINLIDSPGHVDFSSEVTAALRVTDGALXXXXXXXXXXXQTETVLRQAM 509
           K F    ID+PGHVDF  EV A + ++DG +            T  +++ A+
Sbjct: 207 KTFAFQCIDTPGHVDFVDEVAAPMAISDGVVLVVDVIEGVMINTTRIIKHAI 258



 Score = 39.1 bits (87), Expect = 7e-04
 Identities = 23/78 (29%), Positives = 37/78 (47%)
 Frame = +2

Query: 527 ILFMNKMDRXXXXXXXXXXXXYQTFQRIVENVNVIIATYNDDGGPMGEVRVDPSKGSVGF 706
           +L +NK+DR            Y   + +++ VN  I   + D     + RV P  G+V F
Sbjct: 265 VLVLNKVDRLILELRLPPNDAYHKLRHVIDEVNDNICQISKD----LKYRVSPELGNVCF 320

Query: 707 GSGLHGWAFTLKQFSEMY 760
            S   G+ FTL  F+++Y
Sbjct: 321 ASCDLGYCFTLSSFAKLY 338


>SPAC23A1.10 |ef1a-b||translation elongation factor EF-1 alpha
           Ef1a-b |Schizosaccharomyces pombe|chr 1|||Manual
          Length = 460

 Score = 33.9 bits (74), Expect = 0.026
 Identities = 16/32 (50%), Positives = 20/32 (62%)
 Frame = +1

Query: 94  MDKKRNIRNMSVIAHVDHGKSTLTDSLVSKAG 189
           M K++   N+ VI HVD GKST T  L+ K G
Sbjct: 1   MGKEKGHINVVVIGHVDSGKSTTTGHLIYKCG 32


>SPCC794.09c |ef1a-a||translation elongation factor EF-1 alpha
           Ef1a-a |Schizosaccharomyces pombe|chr 3|||Manual
          Length = 460

 Score = 33.9 bits (74), Expect = 0.026
 Identities = 16/32 (50%), Positives = 20/32 (62%)
 Frame = +1

Query: 94  MDKKRNIRNMSVIAHVDHGKSTLTDSLVSKAG 189
           M K++   N+ VI HVD GKST T  L+ K G
Sbjct: 1   MGKEKGHINVVVIGHVDSGKSTTTGHLIYKCG 32


>SPBC839.15c |ef1a-c||translation elongation factor EF-1 alpha
           Ef1a-c |Schizosaccharomyces pombe|chr 2|||Manual
          Length = 460

 Score = 33.9 bits (74), Expect = 0.026
 Identities = 16/32 (50%), Positives = 20/32 (62%)
 Frame = +1

Query: 94  MDKKRNIRNMSVIAHVDHGKSTLTDSLVSKAG 189
           M K++   N+ VI HVD GKST T  L+ K G
Sbjct: 1   MGKEKGHINVVVIGHVDSGKSTTTGHLIYKCG 32


>SPBC9B6.04c |tuf1||mitochondrial translation elongation factor
           EF-Tu Tuf1 |Schizosaccharomyces pombe|chr 2|||Manual
          Length = 439

 Score = 30.3 bits (65), Expect = 0.32
 Identities = 13/25 (52%), Positives = 19/25 (76%)
 Frame = +1

Query: 100 KKRNIRNMSVIAHVDHGKSTLTDSL 174
           KK ++ N+  I HVDHGK+TLT ++
Sbjct: 50  KKPHV-NIGTIGHVDHGKTTLTAAI 73


>SPAC19G12.02c |pms1||MutL family mismatch-repair protein
           Pms1|Schizosaccharomyces pombe|chr 1|||Manual
          Length = 794

 Score = 27.9 bits (59), Expect = 1.7
 Identities = 14/39 (35%), Positives = 26/39 (66%), Gaps = 1/39 (2%)
 Frame = +1

Query: 235 RKDEQDRASPLNLRPSLCSSSLKRKI-*YSSQTLTSVKR 348
           +KD   R+SPLN + +  S  +K+K+  ++S T TS+++
Sbjct: 424 QKDSMRRSSPLNEKVTASSERMKKKLALFASSTDTSMQK 462


>SPBC30B4.01c |wsc1|SPBC3D6.14c|transmembrane receptor Wsc1
           |Schizosaccharomyces pombe|chr 2|||Manual
          Length = 374

 Score = 27.9 bits (59), Expect = 1.7
 Identities = 21/76 (27%), Positives = 36/76 (47%), Gaps = 1/76 (1%)
 Frame = -1

Query: 496 STVSVCTHTPDTQSTT-TRAPSVTRSAAVTSEEKSTCPGESIKLIKKPFSLFSRWSGFVM 320
           +T S  + +P + STT T +PS + S++ +S   S+    S        S  S  S    
Sbjct: 135 TTSSSSSSSPSSSSTTTTTSPSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 194

Query: 319 NTKSFSSSSKNIEMAV 272
           ++ S SSSS +  + +
Sbjct: 195 SSSSSSSSSSSSSVPI 210



 Score = 27.1 bits (57), Expect = 3.0
 Identities = 19/71 (26%), Positives = 33/71 (46%)
 Frame = -1

Query: 499 RSTVSVCTHTPDTQSTTTRAPSVTRSAAVTSEEKSTCPGESIKLIKKPFSLFSRWSGFVM 320
           ++TVS  + +  T S+++ +PS + +   TS   S+    S        S  S  S    
Sbjct: 124 QTTVSSSSVSSTTSSSSSSSPSSSSTTTTTSPSSSSSSSSSSSSSSSSSSSSSSSSSSSS 183

Query: 319 NTKSFSSSSKN 287
           ++ S SSSS +
Sbjct: 184 SSSSSSSSSSS 194


>SPBC1271.15c |||translation initiation factor
           IF-2Mt|Schizosaccharomyces pombe|chr 2|||Manual
          Length = 686

 Score = 27.9 bits (59), Expect = 1.7
 Identities = 13/34 (38%), Positives = 22/34 (64%)
 Frame = +1

Query: 121 MSVIAHVDHGKSTLTDSLVSKAGIIAGARAGETR 222
           ++++ HVDHGK+TL D+   K+ I +    G T+
Sbjct: 174 VTLMGHVDHGKTTLLDAF-RKSTIASTEHGGITQ 206


>SPCC23B6.04c |||sec14 cytosolic factor family|Schizosaccharomyces
           pombe|chr 3|||Manual
          Length = 1008

 Score = 26.6 bits (56), Expect = 4.0
 Identities = 30/114 (26%), Positives = 45/114 (39%), Gaps = 11/114 (9%)
 Frame = +1

Query: 52  SKMVN-FTVDEIRGMMDKKRNIRNMSVIAH--VDHGKSTLTDSLVSKAG----IIAGARA 210
           SKM N   +  I+    K RN      +A   V   K+   D+ +S +     +  G  A
Sbjct: 92  SKMRNTVNLQHIQAANQKTRNAEGERKVAQRRVQSDKAEANDAAMSSSAPTVDVSEGNSA 151

Query: 211 GETRFT----DTRKDEQDRASPLNLRPSLCSSSLKRKI*YSSQTLTSVKRVRKV 360
            E + T    DT +   D    +N+  +   S  K  +   + T  S KRV KV
Sbjct: 152 AEPKITPDDSDTPRLNVDMNDKINVDEAAAKSDSKLNVDQINSTTESEKRVEKV 205


>SPCC584.04 |sup35|erf3|translation release factor eRF3
           |Schizosaccharomyces pombe|chr 3|||Manual
          Length = 662

 Score = 26.2 bits (55), Expect = 5.3
 Identities = 11/26 (42%), Positives = 17/26 (65%)
 Frame = +1

Query: 118 NMSVIAHVDHGKSTLTDSLVSKAGII 195
           N+  I HVD GKSTL  +++   G++
Sbjct: 240 NIVFIGHVDAGKSTLGGNILFLTGMV 265


>SPBC839.07 |ibp1||itty bitty phosphatase Ibp1|Schizosaccharomyces
           pombe|chr 2|||Manual
          Length = 138

 Score = 25.8 bits (54), Expect = 7.0
 Identities = 16/43 (37%), Positives = 22/43 (51%), Gaps = 3/43 (6%)
 Frame = -1

Query: 742 FEGESPPMKTRPETNRALARVDTH---LTHGTTIIVICGYNDV 623
           +EGE  P   R  ++  LA VD H   L    ++IV C Y+ V
Sbjct: 33  YEGERIPGSVRIPSDTFLASVDQHVDDLMKKRSLIVHCTYSQV 75


>SPBC25H2.15 |||programmed cell death protein
           homolog|Schizosaccharomyces pombe|chr 2|||Manual
          Length = 396

 Score = 25.8 bits (54), Expect = 7.0
 Identities = 16/82 (19%), Positives = 39/82 (47%)
 Frame = +1

Query: 112 IRNMSVIAHVDHGKSTLTDSLVSKAGIIAGARAGETRFTDTRKDEQDRASPLNLRPSLCS 291
           +++   I+H++  KS+  +  V+   I + +  G   F+D        +   ++ PS  S
Sbjct: 112 VKSPKAISHLEEKKSSPKEKKVNPFAITSESSRGLNPFSDATSANNPFSLSTDVNPSKPS 171

Query: 292 SSLKRKI*YSSQTLTSVKRVRK 357
           S++  K  ++++   S+   +K
Sbjct: 172 SNVFSKPSFAAKAQQSITDQQK 193


>SPBC21D10.05c |ucp3|soc2|GTPase activating protein Ucp3
           |Schizosaccharomyces pombe|chr 2|||Manual
          Length = 601

 Score = 25.4 bits (53), Expect = 9.2
 Identities = 18/79 (22%), Positives = 38/79 (48%), Gaps = 3/79 (3%)
 Frame = -1

Query: 466 DTQSTTTRAPSV---TRSAAVTSEEKSTCPGESIKLIKKPFSLFSRWSGFVMNTKSFSSS 296
           +  ST ++ PS+   T+S++ +S   ST   +S             +S   +NT +   +
Sbjct: 124 ENHSTNSKPPSLPPRTKSSSQSSPMASTSTSKSRYADSLSTLHDMGFSDDSVNTHALEET 183

Query: 295 SKNIEMAVDLMVMHGLVRP 239
           + ++  A++ +V HG  +P
Sbjct: 184 NGDVTRAIEKIVQHGSSKP 202


>SPCC1322.10 |||conserved fungal protein|Schizosaccharomyces
           pombe|chr 3|||Manual
          Length = 262

 Score = 25.4 bits (53), Expect = 9.2
 Identities = 19/70 (27%), Positives = 33/70 (47%)
 Frame = -1

Query: 496 STVSVCTHTPDTQSTTTRAPSVTRSAAVTSEEKSTCPGESIKLIKKPFSLFSRWSGFVMN 317
           S+ S  T TP + STT+ + S + S  ++S   S+    +   +    S  S  S    +
Sbjct: 140 SSTSSSTATPSSSSTTSSSSSSSSSTPISSSITSSISSSASSSVSSS-SASSSGSISSAD 198

Query: 316 TKSFSSSSKN 287
            K+ S+SS +
Sbjct: 199 AKTVSASSNS 208


>SPAC25G10.02 |cce1|ydc2|mitochondrial cruciform cutting
           endonuclease Cce1|Schizosaccharomyces pombe|chr
           1|||Manual
          Length = 258

 Score = 25.4 bits (53), Expect = 9.2
 Identities = 13/33 (39%), Positives = 20/33 (60%), Gaps = 1/33 (3%)
 Frame = -1

Query: 358 PFSLFSRWSGFVMNTK-SFSSSSKNIEMAVDLM 263
           P S +S W+  V+NTK SFS     ++M  +L+
Sbjct: 168 PKSTYSYWAS-VLNTKASFSKKKSRVQMVKELI 199


>SPBC19F5.03 |||inositol polyphosphate phosphatase
           |Schizosaccharomyces pombe|chr 2|||Manual
          Length = 598

 Score = 25.4 bits (53), Expect = 9.2
 Identities = 11/32 (34%), Positives = 19/32 (59%)
 Frame = -2

Query: 114 DIPLLVHHPTDLVYREIHHFRWFMIFVLLNQL 19
           D P + +H  D  ++E  H RW  + +LLN++
Sbjct: 318 DNPHIHYHYFDF-HKECSHMRWDRVSLLLNEI 348


>SPCC1235.05c |fft2||fun thirty related protein
           Fft2|Schizosaccharomyces pombe|chr 3|||Manual
          Length = 1284

 Score = 25.4 bits (53), Expect = 9.2
 Identities = 12/28 (42%), Positives = 16/28 (57%)
 Frame = -1

Query: 109 SASCPSSHGSRLP*NSPF*MVYDFCSIK 26
           +ASCP SH   L  + PF  + + C IK
Sbjct: 417 TASCPLSHSKLLLEHRPFQTLAEACIIK 444


>SPAP14E8.02 |||transcription factor |Schizosaccharomyces pombe|chr
           1|||Manual
          Length = 566

 Score = 25.4 bits (53), Expect = 9.2
 Identities = 13/37 (35%), Positives = 21/37 (56%), Gaps = 1/37 (2%)
 Frame = +2

Query: 143 ITASQPSRTRWFPR-PVSLLVREPERPVSLTRVRTNK 250
           +T    S T + P  P S + REP  P+S  R+R+++
Sbjct: 48  LTPEPSSNTFYAPSSPASAVRREPLSPMSFVRMRSHR 84


  Database: spombe
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 2,362,478
  Number of sequences in database:  5004
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 3,316,248
Number of Sequences: 5004
Number of extensions: 68502
Number of successful extensions: 244
Number of sequences better than 10.0: 24
Number of HSP's better than 10.0 without gapping: 217
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 237
length of database: 2,362,478
effective HSP length: 71
effective length of database: 2,007,194
effective search space used: 377352472
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -