SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS20050
         (647 letters)

Database: spombe 
           5004 sequences; 2,362,478 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SPCC794.09c |ef1a-a||translation elongation factor EF-1 alpha Ef...   163   3e-41
SPAC23A1.10 |ef1a-b||translation elongation factor EF-1 alpha Ef...   162   3e-41
SPBC839.15c |ef1a-c||translation elongation factor EF-1 alpha Ef...   162   3e-41
SPCC584.04 |sup35|erf3|translation release factor eRF3 |Schizosa...    94   1e-20
SPBC25B2.01 ||SPBC2G5.08|elongation factor 1 alpha related prote...    93   2e-20
SPBC9B6.04c |tuf1||mitochondrial translation elongation factor E...    74   2e-14
SPBC660.10 |||translation elongation factor G|Schizosaccharomyce...    38   0.002
SPCP31B10.07 |eft202||translation elongation factor 2 |Schizosac...    36   0.007
SPBC1306.01c ||SPBC409.22c|translation elongation factor G|Schiz...    36   0.007
SPAC513.01c |eft201|eft2-1, etf2, SPAPYUK71.04c|translation elon...    36   0.007
SPBC1271.15c |||translation initiation factor IF-2Mt|Schizosacch...    34   0.020
SPBC17G9.09 |tif213||translation initiation factor eIF2 gamma su...    33   0.027
SPAC1B3.04c |||mitochondrial GTPase Guf1 |Schizosaccharomyces po...    32   0.082
SPCC553.08c |||GTPase Ria1 |Schizosaccharomyces pombe|chr 3|||Ma...    30   0.25 
SPAC9G1.11c |spn4||septin Spn4|Schizosaccharomyces pombe|chr 1||...    30   0.33 
SPAC56F8.03 |||translation initiation factor IF2 |Schizosaccharo...    29   0.44 
SPCC364.02c |bis1||stress response protein Bis1|Schizosaccharomy...    29   0.76 
SPBC215.12 |cwf10|spef2, snu114|GTPase Cwf10 |Schizosaccharomyce...    27   3.1  
SPCC553.06 |||oligosaccharyltransferase subunit|Schizosaccharomy...    27   3.1  
SPCC364.05 |vps3||GTPase regulator Vps3 |Schizosaccharomyces pom...    27   3.1  
SPBC24C6.08c |||vesicle coat protein|Schizosaccharomyces pombe|c...    25   7.1  
SPBC1703.06 |pof10||F-box protein Pof10|Schizosaccharomyces pomb...    25   7.1  
SPAC3F10.04 |gsa1|gsh2|glutathione synthetase large subunit Gsa1...    25   7.1  
SPBC3E7.06c |||membrane transporter|Schizosaccharomyces pombe|ch...    25   7.1  
SPBC1703.13c |||inorganic phosphate transporter |Schizosaccharom...    25   9.4  

>SPCC794.09c |ef1a-a||translation elongation factor EF-1 alpha
           Ef1a-a |Schizosaccharomyces pombe|chr 3|||Manual
          Length = 460

 Score =  163 bits (395), Expect = 3e-41
 Identities = 81/119 (68%), Positives = 92/119 (77%)
 Frame = +1

Query: 160 QTYHREVREGGPGNG*RILQICLGIGQTKG*AERGITIDIALWKFETSKYYVTIIDAPGH 339
           + + +E  E G G+     +    + + K   ERGITIDIALWKFET KY VT+IDAPGH
Sbjct: 40  EKFEKEATELGKGS----FKYAWVLDKLKAERERGITIDIALWKFETPKYNVTVIDAPGH 95

Query: 340 RDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALLAFTLGVKQLIVGETK 516
           RDFIKNMITGTSQADCAVLI+  GTGEFEAGISK+GQTREHALLA+TLGVKQLIV   K
Sbjct: 96  RDFIKNMITGTSQADCAVLIIGGGTGEFEAGISKDGQTREHALLAYTLGVKQLIVAVNK 154



 Score =  137 bits (331), Expect = 1e-33
 Identities = 62/66 (93%), Positives = 64/66 (96%)
 Frame = +2

Query: 56  MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVL 235
           MGKEK HIN+VVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEA E+GKGSFKYAWVL
Sbjct: 1   MGKEKGHINVVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEATELGKGSFKYAWVL 60

Query: 236 DKLKAE 253
           DKLKAE
Sbjct: 61  DKLKAE 66



 Score = 54.8 bits (126), Expect = 1e-08
 Identities = 22/37 (59%), Positives = 30/37 (81%)
 Frame = +2

Query: 536 YSEPRFEEIKKEVSSYIKKIGYNPAAVAFVPISGWHG 646
           +S+ RFEEI KE S++IKK+G+NP  V FVP+SG+ G
Sbjct: 160 WSQARFEEIVKETSNFIKKVGFNPKTVPFVPVSGFQG 196


>SPAC23A1.10 |ef1a-b||translation elongation factor EF-1 alpha
           Ef1a-b |Schizosaccharomyces pombe|chr 1|||Manual
          Length = 460

 Score =  162 bits (394), Expect = 3e-41
 Identities = 80/119 (67%), Positives = 92/119 (77%)
 Frame = +1

Query: 160 QTYHREVREGGPGNG*RILQICLGIGQTKG*AERGITIDIALWKFETSKYYVTIIDAPGH 339
           + + +E  E G G+     +    + + K   ERGITIDIALWKFET KY VT+IDAPGH
Sbjct: 40  EKFEKEATELGKGS----FKYAWVLDKLKAERERGITIDIALWKFETPKYNVTVIDAPGH 95

Query: 340 RDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALLAFTLGVKQLIVGETK 516
           RDFIKNMITGTSQADCA+LI+  GTGEFEAGISK+GQTREHALLA+TLGVKQLIV   K
Sbjct: 96  RDFIKNMITGTSQADCAILIIGGGTGEFEAGISKDGQTREHALLAYTLGVKQLIVAVNK 154



 Score =  137 bits (331), Expect = 1e-33
 Identities = 62/66 (93%), Positives = 64/66 (96%)
 Frame = +2

Query: 56  MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVL 235
           MGKEK HIN+VVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEA E+GKGSFKYAWVL
Sbjct: 1   MGKEKGHINVVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEATELGKGSFKYAWVL 60

Query: 236 DKLKAE 253
           DKLKAE
Sbjct: 61  DKLKAE 66



 Score = 54.8 bits (126), Expect = 1e-08
 Identities = 22/37 (59%), Positives = 30/37 (81%)
 Frame = +2

Query: 536 YSEPRFEEIKKEVSSYIKKIGYNPAAVAFVPISGWHG 646
           +S+ RFEEI KE S++IKK+G+NP  V FVP+SG+ G
Sbjct: 160 WSQARFEEIVKETSNFIKKVGFNPKTVPFVPVSGFQG 196


>SPBC839.15c |ef1a-c||translation elongation factor EF-1 alpha
           Ef1a-c |Schizosaccharomyces pombe|chr 2|||Manual
          Length = 460

 Score =  162 bits (394), Expect = 3e-41
 Identities = 80/119 (67%), Positives = 92/119 (77%)
 Frame = +1

Query: 160 QTYHREVREGGPGNG*RILQICLGIGQTKG*AERGITIDIALWKFETSKYYVTIIDAPGH 339
           + + +E  E G G+     +    + + K   ERGITIDIALWKFET KY VT+IDAPGH
Sbjct: 40  EKFEKEATELGKGS----FKYAWVLDKLKAERERGITIDIALWKFETPKYNVTVIDAPGH 95

Query: 340 RDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALLAFTLGVKQLIVGETK 516
           RDFIKNMITGTSQADCA+LI+  GTGEFEAGISK+GQTREHALLA+TLGVKQLIV   K
Sbjct: 96  RDFIKNMITGTSQADCAILIIGGGTGEFEAGISKDGQTREHALLAYTLGVKQLIVAVNK 154



 Score =  137 bits (331), Expect = 1e-33
 Identities = 62/66 (93%), Positives = 64/66 (96%)
 Frame = +2

Query: 56  MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVL 235
           MGKEK HIN+VVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEA E+GKGSFKYAWVL
Sbjct: 1   MGKEKGHINVVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEATELGKGSFKYAWVL 60

Query: 236 DKLKAE 253
           DKLKAE
Sbjct: 61  DKLKAE 66



 Score = 54.8 bits (126), Expect = 1e-08
 Identities = 22/37 (59%), Positives = 30/37 (81%)
 Frame = +2

Query: 536 YSEPRFEEIKKEVSSYIKKIGYNPAAVAFVPISGWHG 646
           +S+ RFEEI KE S++IKK+G+NP  V FVP+SG+ G
Sbjct: 160 WSQARFEEIVKETSNFIKKVGFNPKTVPFVPVSGFQG 196


>SPCC584.04 |sup35|erf3|translation release factor eRF3
           |Schizosaccharomyces pombe|chr 3|||Manual
          Length = 662

 Score = 94.3 bits (224), Expect = 1e-20
 Identities = 41/83 (49%), Positives = 58/83 (69%)
 Frame = +1

Query: 256 ERGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGI 435
           E+G T+++    FET     +++DAPGH+ ++ NMI G SQAD  VL+++A  GEFEAG 
Sbjct: 299 EKGKTVEVGRAYFETEHRRFSLLDAPGHKGYVTNMINGASQADIGVLVISARRGEFEAGF 358

Query: 436 SKNGQTREHALLAFTLGVKQLIV 504
            + GQTREHA+LA T G+  L+V
Sbjct: 359 ERGGQTREHAVLARTQGINHLVV 381



 Score = 76.6 bits (180), Expect = 3e-15
 Identities = 33/62 (53%), Positives = 45/62 (72%)
 Frame = +2

Query: 68  KTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLK 247
           K H+NIV IGHVD+GKST  G++++  G +DKRT+EK E+EA+E GK S+  +W LD   
Sbjct: 236 KEHVNIVFIGHVDAGKSTLGGNILFLTGMVDKRTMEKIEREAKEAGKESWYLSWALDSTS 295

Query: 248 AE 253
            E
Sbjct: 296 EE 297


>SPBC25B2.01 ||SPBC2G5.08|elongation factor 1 alpha related
           protein|Schizosaccharomyces pombe|chr 2|||Manual
          Length = 592

 Score = 93.5 bits (222), Expect = 2e-20
 Identities = 50/119 (42%), Positives = 64/119 (53%)
 Frame = +1

Query: 160 QTYHREVREGGPGNG*RILQICLGIGQTKG*AERGITIDIALWKFETSKYYVTIIDAPGH 339
           Q  H E    G G+          +  T+    RG+T+D+A   FE+ K    I DAPGH
Sbjct: 210 QKLHNEAANSGKGS----FSYAWLLDTTEEERARGVTMDVASTTFESDKKIYEIGDAPGH 265

Query: 340 RDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALLAFTLGVKQLIVGETK 516
           RDFI  MI G S AD AVL+V +    FE G  +NGQTREHA L   LG+ +++V   K
Sbjct: 266 RDFISGMIAGASSADFAVLVVDSSQNNFERGFLENGQTREHAYLLRALGISEIVVSVNK 324



 Score = 70.5 bits (165), Expect = 2e-13
 Identities = 30/62 (48%), Positives = 43/62 (69%)
 Frame = +2

Query: 68  KTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLK 247
           K  +++VV GHVDSGKST  G ++++ G I+ R+++K   EA   GKGSF YAW+LD  +
Sbjct: 175 KPVVHLVVTGHVDSGKSTMLGRIMFELGEINSRSMQKLHNEAANSGKGSFSYAWLLDTTE 234

Query: 248 AE 253
            E
Sbjct: 235 EE 236



 Score = 36.7 bits (81), Expect = 0.003
 Identities = 19/38 (50%), Positives = 25/38 (65%), Gaps = 1/38 (2%)
 Frame = +2

Query: 536 YSEPRFEEIKKEVSSY-IKKIGYNPAAVAFVPISGWHG 646
           +SE RF+EIK  VS + IK +G+  + V FVPIS   G
Sbjct: 330 WSEDRFQEIKNIVSDFLIKMVGFKTSNVHFVPISAISG 367


>SPBC9B6.04c |tuf1||mitochondrial translation elongation factor
           EF-Tu Tuf1 |Schizosaccharomyces pombe|chr 2|||Manual
          Length = 439

 Score = 73.7 bits (173), Expect = 2e-14
 Identities = 38/82 (46%), Positives = 53/82 (64%)
 Frame = +1

Query: 259 RGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGIS 438
           RGITI  A  ++ET+  +   +D PGH D+IKNMITG +  D A+++V+A  G+      
Sbjct: 100 RGITISSAHVEYETANRHYAHVDCPGHADYIKNMITGAATMDGAIIVVSATDGQMP---- 155

Query: 439 KNGQTREHALLAFTLGVKQLIV 504
              QTREH LLA  +GVKQ++V
Sbjct: 156 ---QTREHLLLARQVGVKQIVV 174



 Score = 35.1 bits (77), Expect = 0.009
 Identities = 16/29 (55%), Positives = 20/29 (68%)
 Frame = +2

Query: 62  KEKTHINIVVIGHVDSGKSTTTGHLIYKC 148
           ++K H+NI  IGHVD GK+T T   I KC
Sbjct: 49  RKKPHVNIGTIGHVDHGKTTLTA-AITKC 76


>SPBC660.10 |||translation elongation factor G|Schizosaccharomyces
           pombe|chr 2|||Manual
          Length = 813

 Score = 37.5 bits (83), Expect = 0.002
 Identities = 19/54 (35%), Positives = 26/54 (48%)
 Frame = +1

Query: 256 ERGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTG 417
           +RGITI+ A   F      + +ID PGH DF   +    +  D AV I+    G
Sbjct: 76  QRGITINSAAISFTWRNQRINLIDTPGHADFTFEVERSVAVLDGAVAIIDGSAG 129



 Score = 28.7 bits (61), Expect = 0.76
 Identities = 10/24 (41%), Positives = 17/24 (70%)
 Frame = +2

Query: 80  NIVVIGHVDSGKSTTTGHLIYKCG 151
           N+ +I H+D+GK+T T  ++Y  G
Sbjct: 30  NVGIIAHIDAGKTTLTEKMLYYGG 53


>SPCP31B10.07 |eft202||translation elongation factor 2
           |Schizosaccharomyces pombe|chr 3|||Manual
          Length = 842

 Score = 35.5 bits (78), Expect = 0.007
 Identities = 17/32 (53%), Positives = 19/32 (59%)
 Frame = +2

Query: 56  MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCG 151
           MGK     N+ VI HVD GKST T  L+ K G
Sbjct: 13  MGKPSNVRNMSVIAHVDHGKSTLTDSLVQKAG 44



 Score = 27.9 bits (59), Expect = 1.3
 Identities = 11/32 (34%), Positives = 18/32 (56%)
 Frame = +1

Query: 307 YYVTIIDAPGHRDFIKNMITGTSQADCAVLIV 402
           + V +ID+PGH DF   +       D A+++V
Sbjct: 98  FLVNLIDSPGHVDFSSEVTAALRVTDGALVVV 129


>SPBC1306.01c ||SPBC409.22c|translation elongation factor
           G|Schizosaccharomyces pombe|chr 2|||Manual
          Length = 770

 Score = 35.5 bits (78), Expect = 0.007
 Identities = 24/76 (31%), Positives = 35/76 (46%)
 Frame = +1

Query: 292 FETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALL 471
           FE S Y + IID PGH DF   +       D AVL++ A +G     I+ + Q R + + 
Sbjct: 141 FEKS-YNINIIDTPGHIDFTIEVERALRVLDGAVLVLCAVSGVQSQTITVDRQMRRYNVP 199

Query: 472 AFTLGVKQLIVGETKW 519
             +   K   +G   W
Sbjct: 200 RISFVNKMDRMGADPW 215



 Score = 29.1 bits (62), Expect = 0.58
 Identities = 12/26 (46%), Positives = 17/26 (65%)
 Frame = +2

Query: 80  NIVVIGHVDSGKSTTTGHLIYKCGGI 157
           NI +  H+DSGK+T T  ++Y  G I
Sbjct: 61  NIGISAHIDSGKTTFTERVLYYTGRI 86


>SPAC513.01c |eft201|eft2-1, etf2, SPAPYUK71.04c|translation
           elongation factor 2 |Schizosaccharomyces pombe|chr
           1|||Manual
          Length = 842

 Score = 35.5 bits (78), Expect = 0.007
 Identities = 17/32 (53%), Positives = 19/32 (59%)
 Frame = +2

Query: 56  MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCG 151
           MGK     N+ VI HVD GKST T  L+ K G
Sbjct: 13  MGKPSNVRNMSVIAHVDHGKSTLTDSLVQKAG 44



 Score = 27.9 bits (59), Expect = 1.3
 Identities = 11/32 (34%), Positives = 18/32 (56%)
 Frame = +1

Query: 307 YYVTIIDAPGHRDFIKNMITGTSQADCAVLIV 402
           + V +ID+PGH DF   +       D A+++V
Sbjct: 98  FLVNLIDSPGHVDFSSEVTAALRVTDGALVVV 129


>SPBC1271.15c |||translation initiation factor
           IF-2Mt|Schizosaccharomyces pombe|chr 2|||Manual
          Length = 686

 Score = 33.9 bits (74), Expect = 0.020
 Identities = 19/54 (35%), Positives = 26/54 (48%), Gaps = 2/54 (3%)
 Frame = +1

Query: 262 GITIDIALWK--FETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTG 417
           GIT  I  +   F+    ++T +D PGH  F      G + AD  VL+VA   G
Sbjct: 203 GITQKIGAFTVPFDKGSKFITFLDTPGHMAFEAMRKRGANIADIVVLVVAGDDG 256


>SPBC17G9.09 |tif213||translation initiation factor eIF2 gamma
           subunit|Schizosaccharomyces pombe|chr 2|||Manual
          Length = 446

 Score = 33.5 bits (73), Expect = 0.027
 Identities = 18/69 (26%), Positives = 32/69 (46%)
 Frame = +1

Query: 310 YVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALLAFTLGV 489
           +V+ +D PGH   +  M+ G +  D A+L++A              QT EH      + +
Sbjct: 109 HVSFVDCPGHDILMATMLNGAAVMDAALLLIAGNES------CPQPQTSEHLAAIEIMQL 162

Query: 490 KQLIVGETK 516
           K +I+ + K
Sbjct: 163 KHIIILQNK 171



 Score = 25.0 bits (52), Expect = 9.4
 Identities = 12/24 (50%), Positives = 14/24 (58%)
 Frame = +2

Query: 50  PKMGKEKTHINIVVIGHVDSGKST 121
           P +   +  INI  IGHV  GKST
Sbjct: 15  PAIISRQATINIGTIGHVAHGKST 38


>SPAC1B3.04c |||mitochondrial GTPase Guf1 |Schizosaccharomyces
           pombe|chr 1|||Manual
          Length = 646

 Score = 31.9 bits (69), Expect = 0.082
 Identities = 16/57 (28%), Positives = 28/57 (49%), Gaps = 4/57 (7%)
 Frame = +1

Query: 259 RGITIDIA----LWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTG 417
           RGIT+       ++ +    Y + +ID PGH DF   ++   +  +  +L+V A  G
Sbjct: 104 RGITVKAQTCSMIYYYHGQSYLLNLIDTPGHVDFRAEVMHSLAACEGCILLVDASQG 160


>SPCC553.08c |||GTPase Ria1 |Schizosaccharomyces pombe|chr
           3|||Manual
          Length = 1000

 Score = 30.3 bits (65), Expect = 0.25
 Identities = 13/37 (35%), Positives = 21/37 (56%)
 Frame = +1

Query: 307 YYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTG 417
           Y + +ID+PGH DF   + + +   D A ++V A  G
Sbjct: 94  YLINLIDSPGHVDFSSEVSSASRLCDGAFVLVDAVEG 130



 Score = 25.0 bits (52), Expect = 9.4
 Identities = 14/42 (33%), Positives = 21/42 (50%)
 Frame = -3

Query: 582 YEDTSFLISSNLGSLYGGSVEPFCFSYDELFDTEGESEQGML 457
           Y  T+F + ++ G L    V+  C S D+ FD   +SE   L
Sbjct: 791 YVVTAFQLITHQGPLCAEPVQGICVSIDQ-FDISDDSEDSKL 831


>SPAC9G1.11c |spn4||septin Spn4|Schizosaccharomyces pombe|chr
           1|||Manual
          Length = 380

 Score = 29.9 bits (64), Expect = 0.33
 Identities = 14/37 (37%), Positives = 22/37 (59%), Gaps = 2/37 (5%)
 Frame = +1

Query: 253 AERGITIDIALWKFETSKYYV--TIIDAPGHRDFIKN 357
           AE+ + I+I   + E   +++  T+ID PG  DFI N
Sbjct: 67  AEKTVEIEITKAELEEKNFHLRLTVIDTPGFGDFINN 103


>SPAC56F8.03 |||translation initiation factor IF2
           |Schizosaccharomyces pombe|chr 1|||Manual
          Length = 1079

 Score = 29.5 bits (63), Expect = 0.44
 Identities = 12/28 (42%), Positives = 16/28 (57%)
 Frame = +1

Query: 319 IIDAPGHRDFIKNMITGTSQADCAVLIV 402
           IID PGH  F      GTS  + A+L++
Sbjct: 553 IIDTPGHESFTNLRSRGTSLCNIAILVI 580


>SPCC364.02c |bis1||stress response protein Bis1|Schizosaccharomyces
           pombe|chr 3|||Manual
          Length = 384

 Score = 28.7 bits (61), Expect = 0.76
 Identities = 19/60 (31%), Positives = 29/60 (48%)
 Frame = -3

Query: 330 SINDGNIVLASFELPESNIDCDTTLSSAFSLSNTQAYLKDPLPISWASFSNFSMVRLSIP 151
           S++  +  L S+  P S     T L+ A      ++YL+ PL  S  S S  + +R SIP
Sbjct: 305 SVDSASTALNSYSTPNSVSRKLTNLTPAARRLVARSYLRSPLHGSSPSASRHTALRTSIP 364


>SPBC215.12 |cwf10|spef2, snu114|GTPase Cwf10 |Schizosaccharomyces
           pombe|chr 2|||Manual
          Length = 983

 Score = 26.6 bits (56), Expect = 3.1
 Identities = 11/27 (40%), Positives = 16/27 (59%)
 Frame = +1

Query: 322 IDAPGHRDFIKNMITGTSQADCAVLIV 402
           ID PGH DF+  +    + +D  VL+V
Sbjct: 214 IDTPGHVDFVDEVAAPMAISDGVVLVV 240


>SPCC553.06 |||oligosaccharyltransferase subunit|Schizosaccharomyces
           pombe|chr 3|||Manual
          Length = 271

 Score = 26.6 bits (56), Expect = 3.1
 Identities = 27/113 (23%), Positives = 47/113 (41%), Gaps = 4/113 (3%)
 Frame = -3

Query: 507 SYDELFDTEGESEQGMLTGLTVLR-DTSFEFTGTGSYDEHSAISLRGSCDHVLDEISVSR 331
           +YD  F     S    LTG   L    +    GTG+   H A  L    +H    +    
Sbjct: 40  AYDLKFSQIQSSTVYELTGDETLNLKFTCILNGTGAIP-HQAHLLLSDTEHPTLAVIYPA 98

Query: 330 SINDGNIV---LASFELPESNIDCDTTLSSAFSLSNTQAYLKDPLPISWASFS 181
           S++ G +    L  F++P S +  D+TL++   +++    +   LP+   S +
Sbjct: 99  SVSQGGVASLELRLFDIPTSLLRSDSTLTAKLLVASFGETIPFSLPLGQLSIN 151


>SPCC364.05 |vps3||GTPase regulator Vps3 |Schizosaccharomyces
           pombe|chr 3|||Manual
          Length = 910

 Score = 26.6 bits (56), Expect = 3.1
 Identities = 24/82 (29%), Positives = 39/82 (47%), Gaps = 3/82 (3%)
 Frame = -3

Query: 393 HSAISLRGSCDHVLD--EISVSRSINDGNIVLASFELPESNID-CDTTLSSAFSLSNTQA 223
           H   ++  S   ++D   +S+ +SIN  +    SF    +++  CD  + S FS  NT +
Sbjct: 249 HYVFAISSSSLQIIDINTLSLVKSINLKDDESFSFISRLTSVHFCDRQIFSKFSAVNTAS 308

Query: 222 YLKDPLPISWASFSNFSMVRLS 157
             K    I  ASFS  S + L+
Sbjct: 309 TSKTSDTIERASFSKPSFIFLT 330


>SPBC24C6.08c |||vesicle coat protein|Schizosaccharomyces pombe|chr
           2|||Manual
          Length = 367

 Score = 25.4 bits (53), Expect = 7.1
 Identities = 9/30 (30%), Positives = 18/30 (60%)
 Frame = +3

Query: 537 TVSPDLRKSRRKYPHTSRRLATTQLLSLSC 626
           + +PD+     ++PHT +R +T + L + C
Sbjct: 145 STNPDVLYMSSQHPHTQQRYSTLKRLMVRC 174


>SPBC1703.06 |pof10||F-box protein Pof10|Schizosaccharomyces
           pombe|chr 2|||Manual
          Length = 662

 Score = 25.4 bits (53), Expect = 7.1
 Identities = 15/43 (34%), Positives = 19/43 (44%)
 Frame = -1

Query: 242 VCPIPKHI*RILYPFPGPPSRTSRWYVCQYHHICRSSDQWWWT 114
           V  +PK I  I++ F  P S  S    C+Y     S D  W T
Sbjct: 31  VLNLPKEILIIIFSFLDPRSLLSAQCTCKYWKKLLSDDLSWRT 73


>SPAC3F10.04 |gsa1|gsh2|glutathione synthetase large subunit
           Gsa1|Schizosaccharomyces pombe|chr 1|||Manual
          Length = 498

 Score = 25.4 bits (53), Expect = 7.1
 Identities = 16/54 (29%), Positives = 32/54 (59%), Gaps = 1/54 (1%)
 Frame = +2

Query: 170 IEKFEKEA-QEMGKGSFKYAWVLDKLKAELSVVSQSILLSGSSKLASTMLPSLM 328
           IEK+  E  +E+GKG+  +A+    +  ELSV  +   +  ++++  T+ PS++
Sbjct: 3   IEKYTPEQIEELGKGARDFAFAHGVVFTELSVSKEGRNI--ATQIPITLFPSVI 54


>SPBC3E7.06c |||membrane transporter|Schizosaccharomyces pombe|chr
           2|||Manual
          Length = 577

 Score = 25.4 bits (53), Expect = 7.1
 Identities = 16/43 (37%), Positives = 24/43 (55%)
 Frame = -3

Query: 564 LISSNLGSLYGGSVEPFCFSYDELFDTEGESEQGMLTGLTVLR 436
           +I S+LGSL GG+V     +Y ++  T G    G +  L +LR
Sbjct: 395 IIGSSLGSLLGGAVISLTGNYKKI--TVGSYFFGSVAALFMLR 435


>SPBC1703.13c |||inorganic phosphate transporter
           |Schizosaccharomyces pombe|chr 2|||Manual
          Length = 311

 Score = 25.0 bits (52), Expect = 9.4
 Identities = 8/19 (42%), Positives = 12/19 (63%)
 Frame = -1

Query: 197 PGPPSRTSRWYVCQYHHIC 141
           P PP +T + Y  QY+ +C
Sbjct: 8   PAPPKKTLQLYTPQYYGLC 26


  Database: spombe
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 2,362,478
  Number of sequences in database:  5004
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 2,688,381
Number of Sequences: 5004
Number of extensions: 54586
Number of successful extensions: 240
Number of sequences better than 10.0: 25
Number of HSP's better than 10.0 without gapping: 212
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 238
length of database: 2,362,478
effective HSP length: 70
effective length of database: 2,012,198
effective search space used: 291768710
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -