SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS20049
         (646 letters)

Database: spombe 
           5004 sequences; 2,362,478 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SPAPB2C8.01 |||glycoprotein |Schizosaccharomyces pombe|chr 1|||M...    33   0.047
SPCC584.15c |||arrestin/PY protein 2|Schizosaccharomyces pombe|c...    26   5.3  
SPBP23A10.04 |apc2||anaphase-promoting complex subunit Apc2 |Sch...    25   9.3  
SPAC17D4.03c |||membrane transporter |Schizosaccharomyces pombe|...    25   9.3  

>SPAPB2C8.01 |||glycoprotein |Schizosaccharomyces pombe|chr
           1|||Manual
          Length = 1220

 Score = 32.7 bits (71), Expect = 0.047
 Identities = 13/28 (46%), Positives = 18/28 (64%)
 Frame = +3

Query: 21  VLPGHSLCSCPRIITLASSSRTHYIFTM 104
           V P  SL  CP+ +T+ SS  +HYI T+
Sbjct: 41  VTPNTSLAQCPKYVTVYSSGSSHYISTI 68


>SPCC584.15c |||arrestin/PY protein 2|Schizosaccharomyces pombe|chr
           3|||Manual
          Length = 594

 Score = 25.8 bits (54), Expect = 5.3
 Identities = 10/25 (40%), Positives = 13/25 (52%)
 Frame = -3

Query: 314 LMGILPSQHFFKQSHNSYTNHTELP 240
           + G  P++  F   HNSY N   LP
Sbjct: 326 MFGARPTEGVFTGDHNSYVNENILP 350


>SPBP23A10.04 |apc2||anaphase-promoting complex subunit Apc2
           |Schizosaccharomyces pombe|chr 2|||Manual
          Length = 681

 Score = 25.0 bits (52), Expect = 9.3
 Identities = 17/45 (37%), Positives = 24/45 (53%), Gaps = 3/45 (6%)
 Frame = +3

Query: 255 IRVAVMA-LFKKMLRRQYSHESG--KTELVRAQEEYLDRRRTRSL 380
           + V +++ LF   L  +Y H  G  K EL    EEY +R+R R L
Sbjct: 458 LHVTILSRLFWPTLSVRYFHLPGPLKKELDAYAEEYRERKRKREL 502


>SPAC17D4.03c |||membrane transporter |Schizosaccharomyces pombe|chr
           1|||Manual
          Length = 732

 Score = 25.0 bits (52), Expect = 9.3
 Identities = 10/23 (43%), Positives = 13/23 (56%)
 Frame = -1

Query: 232 FREQTDHFHISND*NTNDNFCHH 164
           + E+ DH  IS     ND+ CHH
Sbjct: 554 YNEKCDHESISLQNLDNDHHCHH 576


  Database: spombe
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 2,362,478
  Number of sequences in database:  5004
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 2,859,583
Number of Sequences: 5004
Number of extensions: 61150
Number of successful extensions: 151
Number of sequences better than 10.0: 4
Number of HSP's better than 10.0 without gapping: 146
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 151
length of database: 2,362,478
effective HSP length: 70
effective length of database: 2,012,198
effective search space used: 289756512
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -