SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS20048
         (771 letters)

Database: spombe 
           5004 sequences; 2,362,478 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SPCC970.01 |rad16|rad10, rad20, swi9|DNA repair endonuclease XPF...    33   0.060
SPBC29A10.15 |orc1|orp1, cdc30|origin recognition complex subuni...    26   6.9  
SPBC1734.13 |atp3||F1-ATPase gamma subunit |Schizosaccharomyces ...    25   9.1  
SPBC146.13c |myo1||myosin type I|Schizosaccharomyces pombe|chr 2...    25   9.1  
SPBC530.08 |||transcription factor |Schizosaccharomyces pombe|ch...    25   9.1  

>SPCC970.01 |rad16|rad10, rad20, swi9|DNA repair endonuclease
           XPF|Schizosaccharomyces pombe|chr 3|||Manual
          Length = 892

 Score = 32.7 bits (71), Expect = 0.060
 Identities = 17/43 (39%), Positives = 24/43 (55%)
 Frame = +3

Query: 27  SSKPPEPALQSKPNFTFSSHGIQEANGRVVLGGPNRRSQLTSD 155
           S K PEP+ + + + T S  G+  +  R V GG N  S+ TSD
Sbjct: 442 SIKKPEPSKEREASNTTSRKGVPPSKRRRVRGGNNATSRTTSD 484


>SPBC29A10.15 |orc1|orp1, cdc30|origin recognition complex subunit
           Orc1|Schizosaccharomyces pombe|chr 2|||Manual
          Length = 707

 Score = 25.8 bits (54), Expect = 6.9
 Identities = 10/28 (35%), Positives = 14/28 (50%)
 Frame = +2

Query: 452 VFCGHPYQTECRRKYYTCFKRESIDYNV 535
           V+   P+Q E  R YY   K+  + Y V
Sbjct: 39  VWTEEPFQKEAGRSYYRSLKKNDVIYRV 66


>SPBC1734.13 |atp3||F1-ATPase gamma subunit |Schizosaccharomyces
           pombe|chr 2|||Manual
          Length = 301

 Score = 25.4 bits (53), Expect = 9.1
 Identities = 17/61 (27%), Positives = 26/61 (42%)
 Frame = -2

Query: 188 CGHSSPGCSSLIRGELRTTVRAAKNNTTVCLLDPMATERKVRF*LQSWFGGLRRTAASQP 9
           CG      S LIR EL         NT++C+L      + +RF  +S++        + P
Sbjct: 108 CGGIHSSISRLIRRELHDP--KTFENTSLCILGEKVRTQLLRFCPESFYLTFAHIGGASP 165

Query: 8   S 6
           S
Sbjct: 166 S 166


>SPBC146.13c |myo1||myosin type I|Schizosaccharomyces pombe|chr
            2|||Manual
          Length = 1217

 Score = 25.4 bits (53), Expect = 9.1
 Identities = 8/15 (53%), Positives = 13/15 (86%)
 Frame = +3

Query: 30   SKPPEPALQSKPNFT 74
            ++PP PA+Q++PN T
Sbjct: 1024 NRPPAPAMQARPNTT 1038


>SPBC530.08 |||transcription factor |Schizosaccharomyces pombe|chr
           2|||Manual
          Length = 815

 Score = 25.4 bits (53), Expect = 9.1
 Identities = 9/21 (42%), Positives = 13/21 (61%)
 Frame = -2

Query: 341 NFFRLMIAFNCFRYYYCIFNN 279
           NFF L ++  C  YY+ + NN
Sbjct: 264 NFFPLFLSILCVGYYHHLLNN 284


  Database: spombe
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 2,362,478
  Number of sequences in database:  5004
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 2,964,609
Number of Sequences: 5004
Number of extensions: 56576
Number of successful extensions: 152
Number of sequences better than 10.0: 5
Number of HSP's better than 10.0 without gapping: 147
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 152
length of database: 2,362,478
effective HSP length: 71
effective length of database: 2,007,194
effective search space used: 371330890
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -