SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS20047
         (659 letters)

Database: spombe 
           5004 sequences; 2,362,478 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SPCC162.07 |ent1||epsin|Schizosaccharomyces pombe|chr 3|||Manual       30   0.34 
SPBC3D6.03c |||tRNA endonuclease |Schizosaccharomyces pombe|chr ...    27   1.8  
SPBC21H7.05 |sfc6||transcription factor TFIIIC complex subunit S...    27   2.4  
SPAC16E8.01 |||cytoskeletal protein binding protein Sla1 family ...    27   3.2  
SPAC630.14c |tup12||transcriptional corepressor Tup12 |Schizosac...    27   3.2  
SPAC1782.08c |rex3||exonuclease Rex3 |Schizosaccharomyces pombe|...    26   5.5  
SPBC543.02c |||DNAJ/TPR domain protein DNAJC7 family|Schizosacch...    25   7.3  
SPAC3H1.01c |orp3|orc3, SPAP14E8.06c|origin recognition complex ...    25   9.7  

>SPCC162.07 |ent1||epsin|Schizosaccharomyces pombe|chr 3|||Manual
          Length = 706

 Score = 29.9 bits (64), Expect = 0.34
 Identities = 16/61 (26%), Positives = 25/61 (40%)
 Frame = +3

Query: 198 RRSAVKDPERDHRSHREGKEFKEGHFRVNRLMSESTIDVNHQNGHMNGDADEKISRTLNR 377
           R S   D +RDHRS R  +  + G  R  R     +    H +   N   D ++ R +  
Sbjct: 185 RASRYDDDDRDHRSRRRSRSRRPGRSRSRRRSRRPSPSAEHNSAEEN---DPELQRVIEE 241

Query: 378 A 380
           +
Sbjct: 242 S 242


>SPBC3D6.03c |||tRNA endonuclease |Schizosaccharomyces pombe|chr
           2|||Manual
          Length = 678

 Score = 27.5 bits (58), Expect = 1.8
 Identities = 17/42 (40%), Positives = 23/42 (54%)
 Frame = -1

Query: 248 LSVTSMISLWILDSGSSFKSESPMVKLVTQSDIRMGRKLIIA 123
           LS++S+ S+ I DS S   S +   KLV   D R   KL+ A
Sbjct: 546 LSISSVPSIHINDSYSCIISHTKYGKLVYSGDTRPNEKLVKA 587


>SPBC21H7.05 |sfc6||transcription factor TFIIIC complex subunit
           Sfc6|Schizosaccharomyces pombe|chr 2|||Manual
          Length = 582

 Score = 27.1 bits (57), Expect = 2.4
 Identities = 13/31 (41%), Positives = 19/31 (61%)
 Frame = -1

Query: 278 SEVTFFKFLSLSVTSMISLWILDSGSSFKSE 186
           SE T   F+  S  + I LW L++ ++FKSE
Sbjct: 233 SETTESVFMRTSGRNQIQLWKLENKTNFKSE 263


>SPAC16E8.01 |||cytoskeletal protein binding protein Sla1 family
           |Schizosaccharomyces pombe|chr 1|||Manual
          Length = 1420

 Score = 26.6 bits (56), Expect = 3.2
 Identities = 11/31 (35%), Positives = 16/31 (51%)
 Frame = +3

Query: 177 HGRLTFERRSAVKDPERDHRSHREGKEFKEG 269
           H +     +   K  +R+HR HRE +E  EG
Sbjct: 728 HSKSHDREKEKEKKKDREHRKHRETEEEDEG 758


>SPAC630.14c |tup12||transcriptional corepressor Tup12
           |Schizosaccharomyces pombe|chr 1|||Manual
          Length = 586

 Score = 26.6 bits (56), Expect = 3.2
 Identities = 11/22 (50%), Positives = 16/22 (72%)
 Frame = +2

Query: 521 GKLPPPSNAASTPNTAIAPPLI 586
           G  PPPS++A++  T IA PL+
Sbjct: 213 GHPPPPSDSANSSVTPIAAPLV 234


>SPAC1782.08c |rex3||exonuclease Rex3 |Schizosaccharomyces pombe|chr
           1|||Manual
          Length = 540

 Score = 25.8 bits (54), Expect = 5.5
 Identities = 17/67 (25%), Positives = 29/67 (43%)
 Frame = +3

Query: 186 LTFERRSAVKDPERDHRSHREGKEFKEGHFRVNRLMSESTIDVNHQNGHMNGDADEKISR 365
           L F  R  +       +++   KE K  +FR++ L +     +NHQ  H+  +   K   
Sbjct: 87  LNFNIRQNISTTLNLEKTNDSIKETKNENFRMDVLETYKCKQLNHQTTHLPTNTVLKKRS 146

Query: 366 TLNRAVS 386
             N A+S
Sbjct: 147 LFNDAIS 153


>SPBC543.02c |||DNAJ/TPR domain protein DNAJC7
           family|Schizosaccharomyces pombe|chr 2|||Manual
          Length = 476

 Score = 25.4 bits (53), Expect = 7.3
 Identities = 13/38 (34%), Positives = 20/38 (52%), Gaps = 1/38 (2%)
 Frame = -3

Query: 630 DRRETTGANTGVEGKIRGGA-MAVFGVEAAFEGGGSFP 520
           + R    +   +E  + GGA M  F +  A++ GGSFP
Sbjct: 405 ESRRRFDSGVDLEPGMEGGAGMDPFDILRAYQAGGSFP 442


>SPAC3H1.01c |orp3|orc3, SPAP14E8.06c|origin recognition complex
           subunit Orp3 |Schizosaccharomyces pombe|chr 1|||Manual
          Length = 690

 Score = 25.0 bits (52), Expect = 9.7
 Identities = 11/33 (33%), Positives = 20/33 (60%)
 Frame = +1

Query: 184 DSLLKEDPLSRIQREIIEVTERERNLKKVTSES 282
           D+  +E P   +QRE+ E+ E +R L++   +S
Sbjct: 626 DNHPRESPQGNLQRELNELDEDKRKLEEAKLQS 658


  Database: spombe
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 2,362,478
  Number of sequences in database:  5004
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 2,526,707
Number of Sequences: 5004
Number of extensions: 48721
Number of successful extensions: 163
Number of sequences better than 10.0: 8
Number of HSP's better than 10.0 without gapping: 153
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 163
length of database: 2,362,478
effective HSP length: 70
effective length of database: 2,012,198
effective search space used: 299817502
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -