SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS20041
         (743 letters)

Database: spombe 
           5004 sequences; 2,362,478 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SPBC1198.08 |||dipeptidase Dug1 |Schizosaccharomyces pombe|chr 2...    91   2e-19
SPAC24C9.08 |||vacuolar carboxypeptidase |Schizosaccharomyces po...    35   0.014
SPBC19C7.08c |||leucine carboxyl methyltransferase|Schizosacchar...    26   4.9  
SPCC645.06c |rgf3|lad1|RhoGEF Rgf3|Schizosaccharomyces pombe|chr...    26   4.9  
SPBC215.13 |||sequence orphan|Schizosaccharomyces pombe|chr 2|||...    25   8.6  
SPBC1289.10c |||transcription factor |Schizosaccharomyces pombe|...    25   8.6  
SPBC557.04 |ppk29||Ark1/Prk1 family protein kinase Ppk29|Schizos...    25   8.6  
SPBC16D10.05 |mok13||alpha-1,3-glucan synthase Mok13|Schizosacch...    25   8.6  
SPBC8D2.20c |sec31||COPII-coated vesicle component Sec31 |Schizo...    25   8.6  
SPAC222.13c |||6-phosphofructo-2-kinase |Schizosaccharomyces pom...    25   8.6  
SPAC4F10.13c |mpd2||GYF domain|Schizosaccharomyces pombe|chr 1||...    25   8.6  
SPAC30D11.01c ||SPAC56F8.01|alpha-glucosidase|Schizosaccharomyce...    25   8.6  
SPBC17A3.01c |tim50|SPBC8D2.21c|TIM23 translocase complex subuni...    25   8.6  

>SPBC1198.08 |||dipeptidase Dug1 |Schizosaccharomyces pombe|chr
           2|||Manual
          Length = 474

 Score = 90.6 bits (215), Expect = 2e-19
 Identities = 43/92 (46%), Positives = 58/92 (63%), Gaps = 1/92 (1%)
 Frame = +3

Query: 267 EVGATTELRDVGFQTIDGKDVQXXXXXXXXXXNDPKKNTVCIYGHLDVQPALKSDGWETE 446
           ++GA  E RD+G+  +DG+DV           NDP K TV IY H DVQPA   DGW T+
Sbjct: 53  KLGAKMEKRDIGYHQMDGQDVPLPPIVLGQYGNDPSKKTVLIYNHFDVQPASLEDGWSTD 112

Query: 447 PFEL-VERNEKLYGRGSTDDKGLYLVGCIPSM 539
           PF L V+   +++GRG+TDDKG  L+G I ++
Sbjct: 113 PFTLTVDNKGRMFGRGATDDKG-PLIGWISAI 143



 Score = 48.8 bits (111), Expect = 8e-07
 Identities = 21/38 (55%), Positives = 26/38 (68%)
 Frame = +2

Query: 509 PVLGWLHTINAYKGTGAELPVNLKFIFECMEESGSEGL 622
           P++GW+  I A+K  G + PVNL   FE MEE GSEGL
Sbjct: 135 PLIGWISAIEAHKELGIDFPVNLLMCFEGMEEYGSEGL 172



 Score = 46.4 bits (105), Expect = 4e-06
 Identities = 19/34 (55%), Positives = 23/34 (67%)
 Frame = +1

Query: 640 KLKPEGFFDSVDYVCISDNYWLGTTKPCITNGLR 741
           + + E +F   D VCISD YWLGT KP +T GLR
Sbjct: 177 RAEAEKYFAKADCVCISDTYWLGTKKPVLTYGLR 210



 Score = 37.9 bits (84), Expect = 0.002
 Identities = 16/46 (34%), Positives = 28/46 (60%)
 Frame = +1

Query: 115 TLPEIFKYVDQNKDSYKQLLKEAVAIPSVSCDVKYRADCIRMVHWM 252
           +L ++++ +D+ KD +   L  AV+IPSVS DV  R   + M  ++
Sbjct: 2   SLDKLYEVIDKKKDEFVTRLSRAVSIPSVSADVTLRPKVVEMADFV 47


>SPAC24C9.08 |||vacuolar carboxypeptidase |Schizosaccharomyces
           pombe|chr 1|||Manual
          Length = 596

 Score = 34.7 bits (76), Expect = 0.014
 Identities = 19/57 (33%), Positives = 29/57 (50%), Gaps = 2/57 (3%)
 Frame = +3

Query: 390 IYGHLDVQPALKS--DGWETEPFELVERNEKLYGRGSTDDKGLYLVGCIPSMPIRAL 554
           + GH DV P  ++  D W   PF     N  +Y RG+ DDK   +V  + ++ I A+
Sbjct: 194 LMGHQDVVPVNQASLDRWYFPPFSATYHNGHVYSRGAADDKN-SVVAILEALEILAI 249


>SPBC19C7.08c |||leucine carboxyl
           methyltransferase|Schizosaccharomyces pombe|chr
           2|||Manual
          Length = 681

 Score = 26.2 bits (55), Expect = 4.9
 Identities = 10/22 (45%), Positives = 14/22 (63%)
 Frame = -3

Query: 417 QVVHPNDHRYKLYFFLDHYPIR 352
           ++V P D   + YFFL HY I+
Sbjct: 295 EMVEPFDEWEEFYFFLQHYSIQ 316


>SPCC645.06c |rgf3|lad1|RhoGEF Rgf3|Schizosaccharomyces pombe|chr
           3|||Manual
          Length = 1275

 Score = 26.2 bits (55), Expect = 4.9
 Identities = 29/83 (34%), Positives = 35/83 (42%), Gaps = 13/83 (15%)
 Frame = -2

Query: 445 SVSHPSDFNAGCTSK*P*IQTVFFFGSLPNTPTKTGGS*T------SLPSIV*KPTSLNS 284
           S ++P D +   TS      TV  F  LP TP   GGS         LPS V   +S  S
Sbjct: 129 SPNNPLDTDPFLTSPGNKQNTVDSFRPLPETPVSPGGSLVHPLPRPPLPSSVSSHSSPYS 188

Query: 283 VVAPTS-------FNLSASSEPY 236
             + TS        +LS S EPY
Sbjct: 189 TTSSTSLYSLYNDISLSCSPEPY 211


>SPBC215.13 |||sequence orphan|Schizosaccharomyces pombe|chr
           2|||Manual
          Length = 534

 Score = 25.4 bits (53), Expect = 8.6
 Identities = 23/85 (27%), Positives = 38/85 (44%)
 Frame = -2

Query: 499 SVEPLPYNFSLRSTSSKGSVSHPSDFNAGCTSK*P*IQTVFFFGSLPNTPTKTGGS*TSL 320
           S   +P   S  S++S    S  S   A  +S    I  +    S  ++PT T  + +S 
Sbjct: 236 STSSIPSTSSSSSSTSSSLSSSSSSSTASSSSSSSSI--ISSSSSSSSSPTSTSSTISSS 293

Query: 319 PSIV*KPTSLNSVVAPTSFNLSASS 245
            S    PTS +S ++ +S + S+ S
Sbjct: 294 SSSSSSPTSTSSTISSSSSSSSSFS 318


>SPBC1289.10c |||transcription factor |Schizosaccharomyces pombe|chr
           2|||Manual
          Length = 743

 Score = 25.4 bits (53), Expect = 8.6
 Identities = 14/32 (43%), Positives = 19/32 (59%)
 Frame = +1

Query: 406 MYNLH*NLMDGRLNLLN*LSAMKNYMEEVLLM 501
           +YN + N    RLN      A+KNYMEE+ L+
Sbjct: 435 LYNFNGNANPSRLN-----PALKNYMEELKLL 461


>SPBC557.04 |ppk29||Ark1/Prk1 family protein kinase
           Ppk29|Schizosaccharomyces pombe|chr 2|||Manual
          Length = 872

 Score = 25.4 bits (53), Expect = 8.6
 Identities = 20/66 (30%), Positives = 30/66 (45%), Gaps = 7/66 (10%)
 Frame = -2

Query: 595 TFENELQIDRQ-------LSTSALIGIDGMQPTKYRPLSSVEPLPYNFSLRSTSSKGSVS 437
           TF N   ++RQ       +S+S++ G        Y P S   P P +  +  TSSK S S
Sbjct: 406 TFNNTQDVNRQSVSSPKVVSSSSVTGSGASGRKVYTPQSK-NPFPISQGVTGTSSKFSAS 464

Query: 436 HPSDFN 419
             ++ N
Sbjct: 465 EVTEDN 470


>SPBC16D10.05 |mok13||alpha-1,3-glucan synthase
           Mok13|Schizosaccharomyces pombe|chr 2|||Manual
          Length = 2358

 Score = 25.4 bits (53), Expect = 8.6
 Identities = 10/28 (35%), Positives = 16/28 (57%)
 Frame = -3

Query: 474 FHCAQLVQKVQSPIHQISMQVVHPNDHR 391
           FH +  +  +   IH+I +Q VH  DH+
Sbjct: 796 FHWSGDLINIADGIHEIKLQRVHSQDHQ 823


>SPBC8D2.20c |sec31||COPII-coated vesicle component Sec31
           |Schizosaccharomyces pombe|chr 2|||Manual
          Length = 1224

 Score = 25.4 bits (53), Expect = 8.6
 Identities = 10/24 (41%), Positives = 15/24 (62%)
 Frame = -2

Query: 742 RVNHW*YMASWFPTNSYRIYIHSL 671
           R  +W   +SW P+NS R+ + SL
Sbjct: 301 RSGNWYTKSSWCPSNSNRVAVASL 324


>SPAC222.13c |||6-phosphofructo-2-kinase |Schizosaccharomyces
           pombe|chr 1|||Manual
          Length = 592

 Score = 25.4 bits (53), Expect = 8.6
 Identities = 14/39 (35%), Positives = 21/39 (53%)
 Frame = -2

Query: 487 LPYNFSLRSTSSKGSVSHPSDFNAGCTSK*P*IQTVFFF 371
           L Y   L ST+ + S+S  S FN   + +   I+T+ FF
Sbjct: 406 LRYTNDLASTNKRFSLSEASSFNVWSSVRKRAIETIEFF 444


>SPAC4F10.13c |mpd2||GYF domain|Schizosaccharomyces pombe|chr
           1|||Manual
          Length = 992

 Score = 25.4 bits (53), Expect = 8.6
 Identities = 14/37 (37%), Positives = 21/37 (56%)
 Frame = -2

Query: 358 NTPTKTGGS*TSLPSIV*KPTSLNSVVAPTSFNLSAS 248
           N+ + T G+   L S   KPT+ N V +PTS ++  S
Sbjct: 26  NSSSSTTGAFPQLTSFT-KPTATNGVDSPTSSHIDPS 61


>SPAC30D11.01c ||SPAC56F8.01|alpha-glucosidase|Schizosaccharomyces
           pombe|chr 1|||Manual
          Length = 993

 Score = 25.4 bits (53), Expect = 8.6
 Identities = 24/74 (32%), Positives = 32/74 (43%), Gaps = 1/74 (1%)
 Frame = -2

Query: 619 AFGTRFLHTFE-NELQIDRQLSTSALIGIDGMQPTKYRPLSSVEPLPYNFSLRSTSSKGS 443
           AFG+ + +    + L +D    TS  IG  G    K  P   V P    FSL        
Sbjct: 484 AFGSNYSYDLPFSGLCLDMNEPTSFCIGSCGSDLLKLNP---VHP---PFSLPGDVDNKV 537

Query: 442 VSHPSDFNAGCTSK 401
            S+P DFNA  T++
Sbjct: 538 YSYPEDFNATNTTE 551


>SPBC17A3.01c |tim50|SPBC8D2.21c|TIM23 translocase complex subunit
           Tim50 |Schizosaccharomyces pombe|chr 2|||Manual
          Length = 452

 Score = 25.4 bits (53), Expect = 8.6
 Identities = 14/37 (37%), Positives = 17/37 (45%)
 Frame = +3

Query: 369 PKKNTVCIYGHLDVQPALKSDGWETEPFELVERNEKL 479
           P    + I    DV+P LKS   +  P E   R EKL
Sbjct: 311 PLLEFIAIMDIKDVRPVLKSYQGKNIPLEYARREEKL 347


  Database: spombe
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 2,362,478
  Number of sequences in database:  5004
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 3,338,379
Number of Sequences: 5004
Number of extensions: 72694
Number of successful extensions: 240
Number of sequences better than 10.0: 13
Number of HSP's better than 10.0 without gapping: 227
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 239
length of database: 2,362,478
effective HSP length: 71
effective length of database: 2,007,194
effective search space used: 353266144
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -