SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS20040
         (701 letters)

Database: spombe 
           5004 sequences; 2,362,478 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SPAC25G10.07c |cut7||kinesin-like protein Cut7|Schizosaccharomyc...    28   1.5  
SPBC146.09c |lsd1|swm1, saf110|histone demethylase SWIRM1|Schizo...    28   1.5  
SPBC23E6.09 |ssn6||transcriptional corepressor Ssn6|Schizosaccha...    27   3.4  
SPAC22G7.05 |||krr family protein|Schizosaccharomyces pombe|chr ...    27   3.4  

>SPAC25G10.07c |cut7||kinesin-like protein Cut7|Schizosaccharomyces
           pombe|chr 1|||Manual
          Length = 1085

 Score = 27.9 bits (59), Expect = 1.5
 Identities = 14/39 (35%), Positives = 22/39 (56%), Gaps = 2/39 (5%)
 Frame = +2

Query: 548 EHALKLESDVTNSIREVIKTCESSFNDYHLV--DYLSGE 658
           E   +L   V N I  ++KTC +S ND  ++  DY+S +
Sbjct: 749 ESQKELMYGVRNDIDALVKTCTTSLNDADIILSDYISDQ 787


>SPBC146.09c |lsd1|swm1, saf110|histone demethylase
           SWIRM1|Schizosaccharomyces pombe|chr 2|||Manual
          Length = 1000

 Score = 27.9 bits (59), Expect = 1.5
 Identities = 15/46 (32%), Positives = 23/46 (50%)
 Frame = +2

Query: 539 SALEHALKLESDVTNSIREVIKTCESSFNDYHLVDYLSGEFLDEQY 676
           S L+   K +S+  N IR +I   E++    H    +S  FL+E Y
Sbjct: 669 SQLKKVYKPKSEAINPIRTIISNWENNSYTNHSSYQISNLFLEEDY 714


>SPBC23E6.09 |ssn6||transcriptional corepressor
           Ssn6|Schizosaccharomyces pombe|chr 2|||Manual
          Length = 1102

 Score = 26.6 bits (56), Expect = 3.4
 Identities = 12/28 (42%), Positives = 17/28 (60%), Gaps = 1/28 (3%)
 Frame = +2

Query: 329 NPVLSHG-GLLLDRYGEPPRLREAILRC 409
           +P L +G G+L DRYG      EA ++C
Sbjct: 437 DPKLWYGIGILYDRYGSHEHAEEAFMQC 464


>SPAC22G7.05 |||krr family protein|Schizosaccharomyces pombe|chr
           1|||Manual
          Length = 598

 Score = 26.6 bits (56), Expect = 3.4
 Identities = 13/38 (34%), Positives = 19/38 (50%)
 Frame = +2

Query: 560 KLESDVTNSIREVIKTCESSFNDYHLVDYLSGEFLDEQ 673
           ++E DV  S++        +  DYH    LSGE LD +
Sbjct: 146 EVEKDVQGSLKSKDGFRSVTLKDYHRQKLLSGEILDAE 183


  Database: spombe
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 2,362,478
  Number of sequences in database:  5004
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 2,595,901
Number of Sequences: 5004
Number of extensions: 48553
Number of successful extensions: 132
Number of sequences better than 10.0: 4
Number of HSP's better than 10.0 without gapping: 130
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 132
length of database: 2,362,478
effective HSP length: 71
effective length of database: 2,007,194
effective search space used: 325165428
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -