SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS20037
         (718 letters)

Database: spombe 
           5004 sequences; 2,362,478 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SPCC1739.13 |ssa2||heat shock protein Ssa2|Schizosaccharomyces p...   152   4e-38
SPAC13G7.02c |ssa1||heat shock protein Ssa1|Schizosaccharomyces ...   151   1e-37
SPBC1709.05 |sks2|hsc1|heat shock protein Sks2|Schizosaccharomyc...   134   2e-32
SPAC22A12.15c |bip1|bip|BiP |Schizosaccharomyces pombe|chr 1|||M...   106   3e-24
SPAC664.11 |ssc1|ssp1|Hsp70 chaperone mtHsp70|Schizosaccharomyce...   101   1e-22
SPAC110.04c |pss1|ssp1, SPAP14E8.01c|heat shock protein Pss1|Sch...    72   1e-13
SPAC1F5.06 |||heat shock protein Lhs1 |Schizosaccharomyces pombe...    68   1e-12
SPAC57A7.12 |||heat shock protein Pdr13 |Schizosaccharomyces pom...    60   2e-10
SPBC2D10.17 |clr1||cryptic loci regulator Clr1|Schizosaccharomyc...    29   0.88 
SPBC215.13 |||sequence orphan|Schizosaccharomyces pombe|chr 2|||...    27   2.7  
SPCC74.04 |||amino acid permease, unknown 15|Schizosaccharomyces...    27   3.5  
SPAC24B11.10c |chr3|cfh1|chitin synthase regulatory factor Chr3 ...    26   4.7  
SPCC320.09 |hem15||ferrochelatase|Schizosaccharomyces pombe|chr ...    26   4.7  
SPBC2G2.12 |||histidine-tRNA ligase|Schizosaccharomyces pombe|ch...    26   6.2  
SPAC9.10 |||amino acid permease, unknown 2|Schizosaccharomyces p...    25   8.2  
SPAC4G9.04c |||cleavage and polyadenylation specificity factor |...    25   8.2  

>SPCC1739.13 |ssa2||heat shock protein Ssa2|Schizosaccharomyces
           pombe|chr 3|||Manual
          Length = 647

 Score =  152 bits (369), Expect = 4e-38
 Identities = 73/89 (82%), Positives = 81/89 (91%)
 Frame = +1

Query: 244 KEDLSSSTQASIEIDSLFEGIDFYTSITRARFEELNADLFRSTMEPVEKSLRDAKMDKAQ 423
           K  LSSS QASIEIDSLFEGIDFYTSITRARFEEL ADLFR TMEPVE+ LRD+K+DKA 
Sbjct: 269 KRTLSSSAQASIEIDSLFEGIDFYTSITRARFEELCADLFRKTMEPVERVLRDSKVDKAS 328

Query: 424 IHDIVLVGGSTRIPKVQKLLQDFFNGKEP 510
           +++IVLVGGSTRIP+VQKL+ DFFNGKEP
Sbjct: 329 VNEIVLVGGSTRIPRVQKLVSDFFNGKEP 357



 Score =  150 bits (364), Expect = 2e-37
 Identities = 68/80 (85%), Positives = 76/80 (95%)
 Frame = +2

Query: 14  NVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFVQEFKRKYKKDL 193
           NVLIFDLGGGTFDVS+LTIE+GIFEVK+TAGDTHLGGEDFD+R+VNHF+QEFKRK KKD+
Sbjct: 192 NVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGGEDFDSRLVNHFIQEFKRKNKKDI 251

Query: 194 ATNKRALRRLRTACERAKRT 253
             N RA+RRLRTACERAKRT
Sbjct: 252 TGNARAVRRLRTACERAKRT 271



 Score = 70.5 bits (165), Expect = 2e-13
 Identities = 36/68 (52%), Positives = 41/68 (60%)
 Frame = +3

Query: 513 KSINPDEXXXXXXXXXXXILHGDKSEEVQDXXXXXXXXXXXGIETAGGVMTTLIKRNTTI 692
           KSINPDE           +L GD SE+ QD           GIETAGGVMT LIKRNTTI
Sbjct: 359 KSINPDEAVAYGAAVQAAVLTGDTSEKTQDLLLLDVAPLSMGIETAGGVMTPLIKRNTTI 418

Query: 693 PTKQTQTF 716
           PTK+++ F
Sbjct: 419 PTKKSEIF 426


>SPAC13G7.02c |ssa1||heat shock protein Ssa1|Schizosaccharomyces
           pombe|chr 1|||Manual
          Length = 644

 Score =  151 bits (366), Expect = 1e-37
 Identities = 71/89 (79%), Positives = 82/89 (92%)
 Frame = +1

Query: 244 KEDLSSSTQASIEIDSLFEGIDFYTSITRARFEELNADLFRSTMEPVEKSLRDAKMDKAQ 423
           K  LSSS QASIEIDSL+EGIDFYTSITRARFEEL ADLFR+TMEPVEK LRD+K+DK+ 
Sbjct: 269 KRTLSSSAQASIEIDSLYEGIDFYTSITRARFEELCADLFRNTMEPVEKVLRDSKIDKSS 328

Query: 424 IHDIVLVGGSTRIPKVQKLLQDFFNGKEP 510
           +++IVLVGGSTRIP++QKL+ DFFNGKEP
Sbjct: 329 VNEIVLVGGSTRIPRIQKLVSDFFNGKEP 357



 Score =  149 bits (361), Expect = 4e-37
 Identities = 68/80 (85%), Positives = 75/80 (93%)
 Frame = +2

Query: 14  NVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFVQEFKRKYKKDL 193
           NVLIFDLGGGTFDVS+LTIE+GIFEVK+TAGDTHLGGEDFD+R+VNHF QEFKRK KKD+
Sbjct: 192 NVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGGEDFDSRLVNHFAQEFKRKNKKDI 251

Query: 194 ATNKRALRRLRTACERAKRT 253
             N RA+RRLRTACERAKRT
Sbjct: 252 TGNARAVRRLRTACERAKRT 271



 Score = 70.9 bits (166), Expect = 2e-13
 Identities = 37/68 (54%), Positives = 41/68 (60%)
 Frame = +3

Query: 513 KSINPDEXXXXXXXXXXXILHGDKSEEVQDXXXXXXXXXXXGIETAGGVMTTLIKRNTTI 692
           KSINPDE           IL GD SE+ QD           GIETAGGVMT LIKRNTTI
Sbjct: 359 KSINPDEAVAYGAAVQAAILVGDTSEKTQDLLLLDVAPLSLGIETAGGVMTPLIKRNTTI 418

Query: 693 PTKQTQTF 716
           PTK+++ F
Sbjct: 419 PTKKSEVF 426


>SPBC1709.05 |sks2|hsc1|heat shock protein Sks2|Schizosaccharomyces
           pombe|chr 2|||Manual
          Length = 613

 Score =  134 bits (323), Expect = 2e-32
 Identities = 60/80 (75%), Positives = 71/80 (88%)
 Frame = +2

Query: 11  RNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFVQEFKRKYKKD 190
           +NVLIFDLGGGTFDVS+L I+ G+FEV +TAGDTHLGGEDFDN +V HF+QEFKRK K D
Sbjct: 195 KNVLIFDLGGGTFDVSLLKIQGGVFEVLATAGDTHLGGEDFDNALVEHFIQEFKRKQKID 254

Query: 191 LATNKRALRRLRTACERAKR 250
           ++ + RALRRLR+ACERAKR
Sbjct: 255 ISDDPRALRRLRSACERAKR 274



 Score =  122 bits (293), Expect = 7e-29
 Identities = 55/87 (63%), Positives = 73/87 (83%)
 Frame = +1

Query: 244 KEDLSSSTQASIEIDSLFEGIDFYTSITRARFEELNADLFRSTMEPVEKSLRDAKMDKAQ 423
           K  LSS TQ ++E+DSL  GIDF +SITRARFE++NA  F++T++PV K L+D+K+ KA 
Sbjct: 273 KRALSSVTQTTVEVDSLSNGIDFSSSITRARFEDINATTFKATIDPVAKVLKDSKVPKAD 332

Query: 424 IHDIVLVGGSTRIPKVQKLLQDFFNGK 504
           +HDIVLVGGSTRIPKVQ+L+ DFF+G+
Sbjct: 333 VHDIVLVGGSTRIPKVQRLVSDFFDGR 359



 Score = 38.3 bits (85), Expect = 0.001
 Identities = 23/73 (31%), Positives = 31/73 (42%), Gaps = 1/73 (1%)
 Frame = +3

Query: 501 KGANKSINPDEXXXXXXXXXXXILHGDK-SEEVQDXXXXXXXXXXXGIETAGGVMTTLIK 677
           +  NKSINPDE           +L     S++ QD           G+   G V   +  
Sbjct: 359 RALNKSINPDEAVAYGAAVQAAVLTNKADSDKTQDLLLLDVVPLSLGVAMEGNVFGVVCP 418

Query: 678 RNTTIPTKQTQTF 716
           RNT IPT + +TF
Sbjct: 419 RNTPIPTIKKRTF 431


>SPAC22A12.15c |bip1|bip|BiP |Schizosaccharomyces pombe|chr
           1|||Manual
          Length = 663

 Score =  106 bits (255), Expect = 3e-24
 Identities = 49/89 (55%), Positives = 67/89 (75%)
 Frame = +1

Query: 238 EGKEDLSSSTQASIEIDSLFEGIDFYTSITRARFEELNADLFRSTMEPVEKSLRDAKMDK 417
           + K  LSS     IEI+S F G DF  +++RA+FEE+N DLF+ T++PVE+ L+D+ + K
Sbjct: 299 KAKRTLSSQKSVRIEIESFFNGQDFSETLSRAKFEEINMDLFKKTLKPVEQVLKDSNLKK 358

Query: 418 AQIHDIVLVGGSTRIPKVQKLLQDFFNGK 504
           ++I DIVLVGGSTRIPKVQ+LL+ FF  K
Sbjct: 359 SEIDDIVLVGGSTRIPKVQELLESFFGKK 387



 Score =  105 bits (252), Expect = 6e-24
 Identities = 42/83 (50%), Positives = 67/83 (80%)
 Frame = +2

Query: 5   TRRNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFVQEFKRKYK 184
           T ++++++DLGGGTFDVS+L+I++G+FEV +T+GDTHLGGEDFDNR++N+  + + RK  
Sbjct: 221 TEKHIVVYDLGGGTFDVSLLSIDNGVFEVLATSGDTHLGGEDFDNRVINYLARTYNRKNN 280

Query: 185 KDLATNKRALRRLRTACERAKRT 253
            D+  + +A+ +L+   E+AKRT
Sbjct: 281 VDVTKDLKAMGKLKREVEKAKRT 303



 Score = 52.4 bits (120), Expect = 6e-08
 Identities = 29/72 (40%), Positives = 38/72 (52%)
 Frame = +3

Query: 501 KGANKSINPDEXXXXXXXXXXXILHGDKSEEVQDXXXXXXXXXXXGIETAGGVMTTLIKR 680
           K A+K INPDE           +L G++  +  +           GIET GGVMT LI R
Sbjct: 386 KKASKGINPDEAVAYGAAVQAGVLSGEEGSD--NIVLLDVIPLTLGIETTGGVMTKLIGR 443

Query: 681 NTTIPTKQTQTF 716
           NT IPT+++Q F
Sbjct: 444 NTPIPTRKSQIF 455


>SPAC664.11 |ssc1|ssp1|Hsp70 chaperone mtHsp70|Schizosaccharomyces
           pombe|chr 1|||Manual
          Length = 674

 Score =  101 bits (241), Expect = 1e-22
 Identities = 44/77 (57%), Positives = 60/77 (77%)
 Frame = +2

Query: 17  VLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFVQEFKRKYKKDLA 196
           V +FDLGGGTFD+SIL + +G+FEV+ST GDTHLGGEDFD  +V H V+ FK+    DL+
Sbjct: 237 VAVFDLGGGTFDISILELNNGVFEVRSTNGDTHLGGEDFDVALVRHIVETFKKNEGLDLS 296

Query: 197 TNKRALRRLRTACERAK 247
            ++ A++R+R A E+AK
Sbjct: 297 KDRLAVQRIREAAEKAK 313



 Score = 58.4 bits (135), Expect = 9e-10
 Identities = 25/63 (39%), Positives = 47/63 (74%)
 Frame = +1

Query: 322 ITRARFEELNADLFRSTMEPVEKSLRDAKMDKAQIHDIVLVGGSTRIPKVQKLLQDFFNG 501
           I+RA+FE+L   L R T++P +++L+DA +  ++I++++LVGG TR+P+V + ++  F  
Sbjct: 343 ISRAQFEKLVDPLVRRTIDPCKRALKDANLQTSEINEVILVGGMTRMPRVVETVKSIFK- 401

Query: 502 KEP 510
           +EP
Sbjct: 402 REP 404



 Score = 52.0 bits (119), Expect = 8e-08
 Identities = 29/68 (42%), Positives = 35/68 (51%)
 Frame = +3

Query: 513 KSINPDEXXXXXXXXXXXILHGDKSEEVQDXXXXXXXXXXXGIETAGGVMTTLIKRNTTI 692
           KS+NPDE           +L G     V+D           GIET GGV T LI RNTTI
Sbjct: 406 KSVNPDEAVAIGAAIQGGVLSG----HVKDLVLLDVTPLSLGIETLGGVFTRLINRNTTI 461

Query: 693 PTKQTQTF 716
           PT+++Q F
Sbjct: 462 PTRKSQVF 469


>SPAC110.04c |pss1|ssp1, SPAP14E8.01c|heat shock protein
           Pss1|Schizosaccharomyces pombe|chr 1|||Manual
          Length = 720

 Score = 71.7 bits (168), Expect = 1e-13
 Identities = 34/80 (42%), Positives = 47/80 (58%)
 Frame = +2

Query: 11  RNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFVQEFKRKYKKD 190
           R V I D G   + VSI+    G F +KST  D +LG  + D  ++++F  EFK KYK D
Sbjct: 199 RRVAIVDFGHSNYSVSIVEFSRGQFHIKSTVCDRNLGSRNMDKALIDYFAAEFKEKYKID 258

Query: 191 LATNKRALRRLRTACERAKR 250
           + +N +A  RL TA ER K+
Sbjct: 259 VLSNPKATFRLATAVERLKK 278



 Score = 58.4 bits (135), Expect = 9e-10
 Identities = 28/84 (33%), Positives = 50/84 (59%)
 Frame = +1

Query: 244 KEDLSSSTQASIEIDSLFEGIDFYTSITRARFEELNADLFRSTMEPVEKSLRDAKMDKAQ 423
           K+ LS++  A + ++ +   ID  + I R+ FEEL   L      P+EK+L  A + K  
Sbjct: 277 KKVLSANANAPLNVEMIMNDIDASSFIKRSDFEELIKPLLERLTPPIEKALELAGIKKED 336

Query: 424 IHDIVLVGGSTRIPKVQKLLQDFF 495
           ++ I +VGG TR+P V++++ ++F
Sbjct: 337 LYSIEMVGGCTRVPIVKEVIANYF 360


>SPAC1F5.06 |||heat shock protein Lhs1 |Schizosaccharomyces
           pombe|chr 1|||Manual
          Length = 848

 Score = 68.1 bits (159), Expect = 1e-12
 Identities = 32/83 (38%), Positives = 54/83 (65%)
 Frame = +1

Query: 244 KEDLSSSTQASIEIDSLFEGIDFYTSITRARFEELNADLFRSTMEPVEKSLRDAKMDKAQ 423
           K  LS++++A   I+ L +GIDF   ITR+  E L  D+  + +EP+ K+L+ A +  ++
Sbjct: 305 KHILSANSEAIASIEELADGIDFRLKITRSVLESLCKDMEDAAVEPINKALKKANLTFSE 364

Query: 424 IHDIVLVGGSTRIPKVQKLLQDF 492
           I+ I+L GG++RIP +Q  L D+
Sbjct: 365 INSIILFGGASRIPFIQSTLADY 387


>SPAC57A7.12 |||heat shock protein Pdr13 |Schizosaccharomyces
           pombe|chr 1|||Manual
          Length = 566

 Score = 60.5 bits (140), Expect = 2e-10
 Identities = 28/84 (33%), Positives = 49/84 (58%)
 Frame = +1

Query: 244 KEDLSSSTQASIEIDSLFEGIDFYTSITRARFEELNADLFRSTMEPVEKSLRDAKMDKAQ 423
           K  LS+ T AS  +DSL +GIDF++SI R R++   +       + V +++  A M+   
Sbjct: 295 KRVLSNGTTASAAVDSLADGIDFHSSINRLRYDLAASATLNRMADLVTEAVEKANMEPFD 354

Query: 424 IHDIVLVGGSTRIPKVQKLLQDFF 495
           I +++L GG++  PK+  L++  F
Sbjct: 355 ISEVILAGGASNTPKLTSLMESIF 378



 Score = 58.8 bits (136), Expect = 7e-10
 Identities = 26/80 (32%), Positives = 48/80 (60%)
 Frame = +2

Query: 11  RNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFVQEFKRKYKKD 190
           + V++ + G    +VS+++++ G+  + ++  D +LGGE   + +VN F +EF++K   D
Sbjct: 217 KTVVVANFGATRSEVSVVSVKGGLMTILASVHDENLGGEQLTDVLVNFFAKEFEKKNGID 276

Query: 191 LATNKRALRRLRTACERAKR 250
              N R+L +LR  CE  KR
Sbjct: 277 PRKNARSLAKLRAQCEITKR 296


>SPBC2D10.17 |clr1||cryptic loci regulator Clr1|Schizosaccharomyces
           pombe|chr 2|||Manual
          Length = 1238

 Score = 28.7 bits (61), Expect = 0.88
 Identities = 16/37 (43%), Positives = 21/37 (56%)
 Frame = -2

Query: 135 SKSSPPKWVSPAVDFTSKIPSSMVRMDTSKVPPPRSK 25
           +KSSP K VSP V   SK  +S V  + S +P   +K
Sbjct: 203 NKSSPVKHVSPNVKNNSKKTASSVNSNHSSIPSSITK 239


>SPBC215.13 |||sequence orphan|Schizosaccharomyces pombe|chr
           2|||Manual
          Length = 534

 Score = 27.1 bits (57), Expect = 2.7
 Identities = 22/71 (30%), Positives = 32/71 (45%)
 Frame = -3

Query: 446 PTSTISWI*ALSILASRRDFSTGSMVDLNRSAFSSSKRARVIDV*KSIPSKRESISMLAC 267
           PTS+ S I + S   S   FS+ +    + S+FSS+  +       ++ S   S S  A 
Sbjct: 336 PTSSSSTISSSSSSPSSSSFSSTTSSSKSSSSFSSTVSSSSSTSSSTLTSSSSSSSRPAS 395

Query: 266 VDDDRSSLPSH 234
                SSL SH
Sbjct: 396 SSSHSSSLSSH 406


>SPCC74.04 |||amino acid permease, unknown 15|Schizosaccharomyces
           pombe|chr 3|||Manual
          Length = 557

 Score = 26.6 bits (56), Expect = 3.5
 Identities = 10/28 (35%), Positives = 17/28 (60%)
 Frame = -1

Query: 286 LSQCSLVWTMTGPLCPLTCSTQTPKSSL 203
           +S C ++WTM+G   P   S +T  +S+
Sbjct: 265 MSFCGVIWTMSGYDAPFHMSEETANASV 292


>SPAC24B11.10c |chr3|cfh1|chitin synthase regulatory factor Chr3
           |Schizosaccharomyces pombe|chr 1|||Manual
          Length = 932

 Score = 26.2 bits (55), Expect = 4.7
 Identities = 9/19 (47%), Positives = 14/19 (73%)
 Frame = -1

Query: 430 RGFEPYPSWHHGETSPLAP 374
           +  +P P+  HG+TSPL+P
Sbjct: 420 KAIKPMPTSIHGQTSPLSP 438


>SPCC320.09 |hem15||ferrochelatase|Schizosaccharomyces pombe|chr
           3|||Manual
          Length = 384

 Score = 26.2 bits (55), Expect = 4.7
 Identities = 12/27 (44%), Positives = 15/27 (55%)
 Frame = -2

Query: 171 LNSWTKWLTMRLSKSSPPKWVSPAVDF 91
           LN   K++    SK  P  W+SPA DF
Sbjct: 256 LNYKNKFVNAWQSKVGPLPWMSPATDF 282


>SPBC2G2.12 |||histidine-tRNA ligase|Schizosaccharomyces pombe|chr
           2|||Manual
          Length = 538

 Score = 25.8 bits (54), Expect = 6.2
 Identities = 17/53 (32%), Positives = 27/53 (50%)
 Frame = +1

Query: 289 SLFEGIDFYTSITRARFEELNADLFRSTMEPVEKSLRDAKMDKAQIHDIVLVG 447
           SL  G+D+YT I      E +A   +S+ E  +K   D + D++   D + VG
Sbjct: 331 SLARGLDYYTGIIYEAVTEASAPKIKSSAE--KKKSADPEADRSN-DDSIGVG 380


>SPAC9.10 |||amino acid permease, unknown 2|Schizosaccharomyces
           pombe|chr 1|||Manual
          Length = 591

 Score = 25.4 bits (53), Expect = 8.2
 Identities = 13/34 (38%), Positives = 18/34 (52%), Gaps = 4/34 (11%)
 Frame = +2

Query: 356 ICSGLPWSQ----WRSLSVMPRWIRLKSTILYWW 445
           ICS LP +     W + S  PR+ R  S ++ WW
Sbjct: 133 ICSALPAAGSIYLWAAESAGPRFGRFVSFLVAWW 166


>SPAC4G9.04c |||cleavage and polyadenylation specificity factor
           |Schizosaccharomyces pombe|chr 1|||Manual
          Length = 638

 Score = 25.4 bits (53), Expect = 8.2
 Identities = 10/27 (37%), Positives = 18/27 (66%)
 Frame = +3

Query: 39  AVPSTCPSLPSRMVSSR*NPPPATPTW 119
           ++PST P++PS   +S  + PP T ++
Sbjct: 299 SIPSTIPTIPSAYSASVSSQPPLTHSY 325


  Database: spombe
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 2,362,478
  Number of sequences in database:  5004
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 2,993,346
Number of Sequences: 5004
Number of extensions: 62458
Number of successful extensions: 261
Number of sequences better than 10.0: 16
Number of HSP's better than 10.0 without gapping: 225
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 260
length of database: 2,362,478
effective HSP length: 71
effective length of database: 2,007,194
effective search space used: 335201398
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -