SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS20035
         (493 letters)

Database: spombe 
           5004 sequences; 2,362,478 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SPBC776.11 |rpl2801|rpl28-1|60S ribosomal protein Ll28B 27a|Schi...    81   9e-17
SPCC5E4.07 |rpl2802|rpl28-2|60S ribosomal protein L27a.2/L28A|Sc...    81   1e-16
SPBC1921.02 |rad60||DNA repair protein Rad60 |Schizosaccharomyce...    25   8.2  

>SPBC776.11 |rpl2801|rpl28-1|60S ribosomal protein Ll28B
           27a|Schizosaccharomyces pombe|chr 2|||Manual
          Length = 148

 Score = 81.0 bits (191), Expect = 9e-17
 Identities = 39/78 (50%), Positives = 44/78 (56%)
 Frame = +1

Query: 22  MATSKKKTRKLRGHVSXXXXXXXXXXXXXXXXXNAGGEHHHRINMDKYHPGYFGKLGMRN 201
           M T   KTRKLRGHVS                  AGG  H R + DKYHPGYFGK+GMR 
Sbjct: 1   MPTHTSKTRKLRGHVSAGHGRIGKHRKHPGGRGKAGGLQHLRSHFDKYHPGYFGKVGMRR 60

Query: 202 FHFRKNKNFCPVLNLDKL 255
           FH  KN  + P +NLD+L
Sbjct: 61  FHLMKNPLWRPTVNLDRL 78



 Score = 35.1 bits (77), Expect = 0.006
 Identities = 24/89 (26%), Positives = 33/89 (37%)
 Frame = +3

Query: 198 KFPL*KEQEFLSSFELR*AWTLVSEQTRLKYASAPDGKVPVINIVKAXXXXXXXXXXXPK 377
           +F L K   +  +  L   WTLV  +TR KY        PVIN++++           P 
Sbjct: 60  RFHLMKNPLWRPTVNLDRLWTLVPNETREKYLGKNTEVAPVINVLQSGYGKVLGKGRLPD 119

Query: 378 QPVIVXXXXXXXXXXXXXXDVGGACVLSA 464
            PVI+                GG   L A
Sbjct: 120 TPVIIQTRYVSRRAEEKIKQAGGVVELIA 148


>SPCC5E4.07 |rpl2802|rpl28-2|60S ribosomal protein
           L27a.2/L28A|Schizosaccharomyces pombe|chr 3|||Manual
          Length = 148

 Score = 80.6 bits (190), Expect = 1e-16
 Identities = 39/78 (50%), Positives = 44/78 (56%)
 Frame = +1

Query: 22  MATSKKKTRKLRGHVSXXXXXXXXXXXXXXXXXNAGGEHHHRINMDKYHPGYFGKLGMRN 201
           M T   KTRKLRGHVS                  AGG  H R + DKYHPGYFGK+GMR 
Sbjct: 1   MPTHVSKTRKLRGHVSAGHGRIGKHRKHPGGRGKAGGLQHLRSHFDKYHPGYFGKVGMRR 60

Query: 202 FHFRKNKNFCPVLNLDKL 255
           FH  KN  + P +NLD+L
Sbjct: 61  FHLMKNPLWRPTVNLDRL 78



 Score = 32.7 bits (71), Expect = 0.031
 Identities = 23/89 (25%), Positives = 33/89 (37%)
 Frame = +3

Query: 198 KFPL*KEQEFLSSFELR*AWTLVSEQTRLKYASAPDGKVPVINIVKAXXXXXXXXXXXPK 377
           +F L K   +  +  L   WTL+  + R KY        PVIN++++           P+
Sbjct: 60  RFHLMKNPLWRPTVNLDRLWTLLPNEARDKYLGKNTEVAPVINVLQSGYGKVLGKGRLPE 119

Query: 378 QPVIVXXXXXXXXXXXXXXDVGGACVLSA 464
            PVIV                GG   L A
Sbjct: 120 TPVIVQTRYVSRRAEEKIKQAGGVVELIA 148


>SPBC1921.02 |rad60||DNA repair protein Rad60 |Schizosaccharomyces
           pombe|chr 2|||Manual
          Length = 406

 Score = 24.6 bits (51), Expect = 8.2
 Identities = 10/20 (50%), Positives = 15/20 (75%)
 Frame = -3

Query: 332 DNIDDGDLAIWSRCILQPRL 273
           DN+D+ DLA +S+ I +P L
Sbjct: 2   DNLDEDDLAFFSKPIKKPPL 21


  Database: spombe
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 2,362,478
  Number of sequences in database:  5004
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 1,891,247
Number of Sequences: 5004
Number of extensions: 36199
Number of successful extensions: 80
Number of sequences better than 10.0: 3
Number of HSP's better than 10.0 without gapping: 76
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 78
length of database: 2,362,478
effective HSP length: 68
effective length of database: 2,022,206
effective search space used: 192109570
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -