SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS20030
         (713 letters)

Database: spombe 
           5004 sequences; 2,362,478 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SPCC794.09c |ef1a-a||translation elongation factor EF-1 alpha Ef...   258   4e-70
SPAC23A1.10 |ef1a-b||translation elongation factor EF-1 alpha Ef...   258   6e-70
SPBC839.15c |ef1a-c||translation elongation factor EF-1 alpha Ef...   258   6e-70
SPCC584.04 |sup35|erf3|translation release factor eRF3 |Schizosa...   161   7e-41
SPBC25B2.01 ||SPBC2G5.08|elongation factor 1 alpha related prote...   154   1e-38
SPBC9B6.04c |tuf1||mitochondrial translation elongation factor E...    90   3e-19
SPBC660.10 |||translation elongation factor G|Schizosaccharomyce...    40   4e-04
SPBC17G9.09 |tif213||translation initiation factor eIF2 gamma su...    38   0.001
SPCP31B10.07 |eft202||translation elongation factor 2 |Schizosac...    34   0.023
SPBC1306.01c ||SPBC409.22c|translation elongation factor G|Schiz...    34   0.023
SPAC513.01c |eft201|eft2-1, etf2, SPAPYUK71.04c|translation elon...    34   0.023
SPAC323.04 |||mitochondrial ATPase |Schizosaccharomyces pombe|ch...    29   0.87 
SPAC56F8.03 |||translation initiation factor IF2 |Schizosaccharo...    28   1.5  
SPAC1952.11c |ure2||urease |Schizosaccharomyces pombe|chr 1|||Ma...    28   1.5  
SPBC1271.15c |||translation initiation factor IF-2Mt|Schizosacch...    27   2.7  
SPBC215.12 |cwf10|spef2, snu114|GTPase Cwf10 |Schizosaccharomyce...    27   3.5  
SPBC1703.06 |pof10||F-box protein Pof10|Schizosaccharomyces pomb...    26   6.1  
SPCC1840.03 |sal3|pse1|karyopherin Sal3|Schizosaccharomyces pomb...    25   8.1  
SPCC1450.11c |cek1||serine/threonine protein kinase Cek1|Schizos...    25   8.1  

>SPCC794.09c |ef1a-a||translation elongation factor EF-1 alpha
           Ef1a-a |Schizosaccharomyces pombe|chr 3|||Manual
          Length = 460

 Score =  258 bits (633), Expect = 4e-70
 Identities = 129/166 (77%), Positives = 139/166 (83%)
 Frame = +1

Query: 10  INIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLKAER 189
           IN+VVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEA E+GKGSFKYAWVLDKLKAER
Sbjct: 8   INVVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEATELGKGSFKYAWVLDKLKAER 67

Query: 190 ERRYHNRYCSLEVRN*QVLCYHIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGI 369
           ER         +    +     IDAPGHRDFIKNMITGTSQADCAVLI+  GTGEFEAGI
Sbjct: 68  ERGITIDIALWKFETPKYNVTVIDAPGHRDFIKNMITGTSQADCAVLIIGGGTGEFEAGI 127

Query: 370 SKNGQTREHALLAFTLGVKQLIVGVNKMDSTEPPYSEPRFEEIKKE 507
           SK+GQTREHALLA+TLGVKQLIV VNKMD+T   +S+ RFEEI KE
Sbjct: 128 SKDGQTREHALLAYTLGVKQLIVAVNKMDTT--GWSQARFEEIVKE 171



 Score = 98.3 bits (234), Expect = 1e-21
 Identities = 39/65 (60%), Positives = 52/65 (80%)
 Frame = +3

Query: 510 SSYIKKIGYNPAAVAFVPISGWHGDNMLEPSTKMPWFKGWQVERKEGKADGKCLIEALDA 689
           S++IKK+G+NP  V FVP+SG+ GDNM+EP+T MPW++GWQ E K G   GK L+EA+D+
Sbjct: 173 SNFIKKVGFNPKTVPFVPVSGFQGDNMIEPTTNMPWYQGWQKETKAGVVKGKTLLEAIDS 232

Query: 690 ILPPA 704
           I PPA
Sbjct: 233 IEPPA 237


>SPAC23A1.10 |ef1a-b||translation elongation factor EF-1 alpha
           Ef1a-b |Schizosaccharomyces pombe|chr 1|||Manual
          Length = 460

 Score =  258 bits (632), Expect = 6e-70
 Identities = 128/166 (77%), Positives = 139/166 (83%)
 Frame = +1

Query: 10  INIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLKAER 189
           IN+VVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEA E+GKGSFKYAWVLDKLKAER
Sbjct: 8   INVVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEATELGKGSFKYAWVLDKLKAER 67

Query: 190 ERRYHNRYCSLEVRN*QVLCYHIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGI 369
           ER         +    +     IDAPGHRDFIKNMITGTSQADCA+LI+  GTGEFEAGI
Sbjct: 68  ERGITIDIALWKFETPKYNVTVIDAPGHRDFIKNMITGTSQADCAILIIGGGTGEFEAGI 127

Query: 370 SKNGQTREHALLAFTLGVKQLIVGVNKMDSTEPPYSEPRFEEIKKE 507
           SK+GQTREHALLA+TLGVKQLIV VNKMD+T   +S+ RFEEI KE
Sbjct: 128 SKDGQTREHALLAYTLGVKQLIVAVNKMDTT--GWSQARFEEIVKE 171



 Score = 98.3 bits (234), Expect = 1e-21
 Identities = 39/65 (60%), Positives = 52/65 (80%)
 Frame = +3

Query: 510 SSYIKKIGYNPAAVAFVPISGWHGDNMLEPSTKMPWFKGWQVERKEGKADGKCLIEALDA 689
           S++IKK+G+NP  V FVP+SG+ GDNM+EP+T MPW++GWQ E K G   GK L+EA+D+
Sbjct: 173 SNFIKKVGFNPKTVPFVPVSGFQGDNMIEPTTNMPWYQGWQKETKAGVVKGKTLLEAIDS 232

Query: 690 ILPPA 704
           I PPA
Sbjct: 233 IEPPA 237


>SPBC839.15c |ef1a-c||translation elongation factor EF-1 alpha
           Ef1a-c |Schizosaccharomyces pombe|chr 2|||Manual
          Length = 460

 Score =  258 bits (632), Expect = 6e-70
 Identities = 128/166 (77%), Positives = 139/166 (83%)
 Frame = +1

Query: 10  INIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLKAER 189
           IN+VVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEA E+GKGSFKYAWVLDKLKAER
Sbjct: 8   INVVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEATELGKGSFKYAWVLDKLKAER 67

Query: 190 ERRYHNRYCSLEVRN*QVLCYHIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGI 369
           ER         +    +     IDAPGHRDFIKNMITGTSQADCA+LI+  GTGEFEAGI
Sbjct: 68  ERGITIDIALWKFETPKYNVTVIDAPGHRDFIKNMITGTSQADCAILIIGGGTGEFEAGI 127

Query: 370 SKNGQTREHALLAFTLGVKQLIVGVNKMDSTEPPYSEPRFEEIKKE 507
           SK+GQTREHALLA+TLGVKQLIV VNKMD+T   +S+ RFEEI KE
Sbjct: 128 SKDGQTREHALLAYTLGVKQLIVAVNKMDTT--GWSQARFEEIVKE 171



 Score = 98.3 bits (234), Expect = 1e-21
 Identities = 39/65 (60%), Positives = 52/65 (80%)
 Frame = +3

Query: 510 SSYIKKIGYNPAAVAFVPISGWHGDNMLEPSTKMPWFKGWQVERKEGKADGKCLIEALDA 689
           S++IKK+G+NP  V FVP+SG+ GDNM+EP+T MPW++GWQ E K G   GK L+EA+D+
Sbjct: 173 SNFIKKVGFNPKTVPFVPVSGFQGDNMIEPTTNMPWYQGWQKETKAGVVKGKTLLEAIDS 232

Query: 690 ILPPA 704
           I PPA
Sbjct: 233 IEPPA 237


>SPCC584.04 |sup35|erf3|translation release factor eRF3
           |Schizosaccharomyces pombe|chr 3|||Manual
          Length = 662

 Score =  161 bits (392), Expect = 7e-41
 Identities = 83/182 (45%), Positives = 114/182 (62%), Gaps = 4/182 (2%)
 Frame = +1

Query: 1   RHEINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLK 180
           +  +NIV IGHVD+GKST  G++++  G +DKRT+EK E+EA+E GK S+  +W LD   
Sbjct: 236 KEHVNIVFIGHVDAGKSTLGGNILFLTGMVDKRTMEKIEREAKEAGKESWYLSWALDSTS 295

Query: 181 AERER----RYHNRYCSLEVRN*QVLCYHIDAPGHRDFIKNMITGTSQADCAVLIVAAGT 348
            ERE+         Y   E R   +L    DAPGH+ ++ NMI G SQAD  VL+++A  
Sbjct: 296 EEREKGKTVEVGRAYFETEHRRFSLL----DAPGHKGYVTNMINGASQADIGVLVISARR 351

Query: 349 GEFEAGISKNGQTREHALLAFTLGVKQLIVGVNKMDSTEPPYSEPRFEEIKKEDPHTSRR 528
           GEFEAG  + GQTREHA+LA T G+  L+V +NKMD     +SE R++E   +     RR
Sbjct: 352 GEFEAGFERGGQTREHAVLARTQGINHLVVVINKMDEPSVQWSEERYKECVDKLSMFLRR 411

Query: 529 LA 534
           +A
Sbjct: 412 VA 413


>SPBC25B2.01 ||SPBC2G5.08|elongation factor 1 alpha related
           protein|Schizosaccharomyces pombe|chr 2|||Manual
          Length = 592

 Score =  154 bits (373), Expect = 1e-38
 Identities = 77/164 (46%), Positives = 103/164 (62%)
 Frame = +1

Query: 10  INIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLKAER 189
           +++VV GHVDSGKST  G ++++ G I+ R+++K   EA   GKGSF YAW+LD  + ER
Sbjct: 178 VHLVVTGHVDSGKSTMLGRIMFELGEINSRSMQKLHNEAANSGKGSFSYAWLLDTTEEER 237

Query: 190 ERRYHNRYCSLEVRN*QVLCYHIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGI 369
            R       S    + + +    DAPGHRDFI  MI G S AD AVL+V +    FE G 
Sbjct: 238 ARGVTMDVASTTFESDKKIYEIGDAPGHRDFISGMIAGASSADFAVLVVDSSQNNFERGF 297

Query: 370 SKNGQTREHALLAFTLGVKQLIVGVNKMDSTEPPYSEPRFEEIK 501
            +NGQTREHA L   LG+ +++V VNK+D     +SE RF+EIK
Sbjct: 298 LENGQTREHAYLLRALGISEIVVSVNKLDLMS--WSEDRFQEIK 339



 Score = 31.9 bits (69), Expect = 0.094
 Identities = 21/63 (33%), Positives = 31/63 (49%), Gaps = 2/63 (3%)
 Frame = +3

Query: 519 IKKIGYNPAAVAFVPISGWHGDNML--EPSTKMPWFKGWQVERKEGKADGKCLIEALDAI 692
           IK +G+  + V FVPIS   G N++  + S    W+K            G  L+ ALD +
Sbjct: 347 IKMVGFKTSNVHFVPISAISGTNLIQKDSSDLYKWYK------------GPTLLSALDQL 394

Query: 693 LPP 701
           +PP
Sbjct: 395 VPP 397


>SPBC9B6.04c |tuf1||mitochondrial translation elongation factor
           EF-Tu Tuf1 |Schizosaccharomyces pombe|chr 2|||Manual
          Length = 439

 Score = 90.2 bits (214), Expect = 3e-19
 Identities = 59/157 (37%), Positives = 80/157 (50%)
 Frame = +1

Query: 10  INIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLKAER 189
           +NI  IGHVD GK+T T   I KC                ++G+ SF     +DK   E+
Sbjct: 54  VNIGTIGHVDHGKTTLTA-AITKC--------------LSDLGQASFMDYSQIDKAPEEK 98

Query: 190 ERRYHNRYCSLEVRN*QVLCYHIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGI 369
            R        +E         H+D PGH D+IKNMITG +  D A+++V+A  G+     
Sbjct: 99  ARGITISSAHVEYETANRHYAHVDCPGHADYIKNMITGAATMDGAIIVVSATDGQMP--- 155

Query: 370 SKNGQTREHALLAFTLGVKQLIVGVNKMDSTEPPYSE 480
               QTREH LLA  +GVKQ++V +NK+D  EP   E
Sbjct: 156 ----QTREHLLLARQVGVKQIVVYINKVDMVEPDMIE 188


>SPBC660.10 |||translation elongation factor G|Schizosaccharomyces
           pombe|chr 2|||Manual
          Length = 813

 Score = 39.9 bits (89), Expect = 4e-04
 Identities = 45/150 (30%), Positives = 68/150 (45%), Gaps = 2/150 (1%)
 Frame = +1

Query: 13  NIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLKAERE 192
           N+ +I H+D+GK+T T  ++Y  G         F      +  G      V+D L AER+
Sbjct: 30  NVGIIAHIDAGKTTLTEKMLYYGG---------FTSHFGNVDTGDT----VMDYLPAERQ 76

Query: 193 R--RYHNRYCSLEVRN*QVLCYHIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAG 366
           R    ++   S   RN ++    ID PGH DF   +    +  D AV I+     +  AG
Sbjct: 77  RGITINSAAISFTWRNQRINL--IDTPGHADFTFEVERSVAVLDGAVAII-----DGSAG 129

Query: 367 ISKNGQTREHALLAFTLGVKQLIVGVNKMD 456
           +    QT+     A   G+ ++I  VNKMD
Sbjct: 130 V--EAQTKVVWKQATKRGIPKVIF-VNKMD 156


>SPBC17G9.09 |tif213||translation initiation factor eIF2 gamma
           subunit|Schizosaccharomyces pombe|chr 2|||Manual
          Length = 446

 Score = 38.3 bits (85), Expect = 0.001
 Identities = 22/83 (26%), Positives = 37/83 (44%)
 Frame = +1

Query: 256 IDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALLAFTLGVKQLI 435
           +D PGH   +  M+ G +  D A+L++A              QT EH      + +K +I
Sbjct: 113 VDCPGHDILMATMLNGAAVMDAALLLIAGNES------CPQPQTSEHLAAIEIMQLKHII 166

Query: 436 VGVNKMDSTEPPYSEPRFEEIKK 504
           +  NK+D      +E  ++ I K
Sbjct: 167 ILQNKVDLIRESAAEEHYQSILK 189


>SPCP31B10.07 |eft202||translation elongation factor 2
           |Schizosaccharomyces pombe|chr 3|||Manual
          Length = 842

 Score = 33.9 bits (74), Expect = 0.023
 Identities = 34/111 (30%), Positives = 47/111 (42%), Gaps = 3/111 (2%)
 Frame = +1

Query: 13  NIVVIGHVDSGKSTTTGHLIYKCGGID--KRTIEKF-EKEAQEMGKGSFKYAWVLDKLKA 183
           N+ VI HVD GKST T  L+ K G I   K    +F +  A E  +G    +  +  L A
Sbjct: 21  NMSVIAHVDHGKSTLTDSLVQKAGIISAAKAGDARFMDTRADEQERGVTIKSTAI-SLFA 79

Query: 184 ERERRYHNRYCSLEVRN*QVLCYHIDAPGHRDFIKNMITGTSQADCAVLIV 336
           E       +           L   ID+PGH DF   +       D A+++V
Sbjct: 80  EMTDD-DMKDMKEPADGTDFLVNLIDSPGHVDFSSEVTAALRVTDGALVVV 129


>SPBC1306.01c ||SPBC409.22c|translation elongation factor
           G|Schizosaccharomyces pombe|chr 2|||Manual
          Length = 770

 Score = 33.9 bits (74), Expect = 0.023
 Identities = 33/136 (24%), Positives = 53/136 (38%), Gaps = 8/136 (5%)
 Frame = +1

Query: 13  NIVVIGHVDSGKSTTTGHLIYKCGGI-DKRTIEKFEKEAQEMGKGSFKYAWVLDKLKAER 189
           NI +  H+DSGK+T T  ++Y  G I D   +   +    +M     +    +    A  
Sbjct: 61  NIGISAHIDSGKTTFTERVLYYTGRIKDIHEVRGKDNVGAKMDFMELEREKGITIQSAAT 120

Query: 190 ERRYHNRYCSLEVRN*QVLCYH-------IDAPGHRDFIKNMITGTSQADCAVLIVAAGT 348
              +      +E    Q   +        ID PGH DF   +       D AVL++ A +
Sbjct: 121 HCTWERTVDQIEANEKQKTDFEKSYNINIIDTPGHIDFTIEVERALRVLDGAVLVLCAVS 180

Query: 349 GEFEAGISKNGQTREH 396
           G     I+ + Q R +
Sbjct: 181 GVQSQTITVDRQMRRY 196


>SPAC513.01c |eft201|eft2-1, etf2, SPAPYUK71.04c|translation
           elongation factor 2 |Schizosaccharomyces pombe|chr
           1|||Manual
          Length = 842

 Score = 33.9 bits (74), Expect = 0.023
 Identities = 34/111 (30%), Positives = 47/111 (42%), Gaps = 3/111 (2%)
 Frame = +1

Query: 13  NIVVIGHVDSGKSTTTGHLIYKCGGID--KRTIEKF-EKEAQEMGKGSFKYAWVLDKLKA 183
           N+ VI HVD GKST T  L+ K G I   K    +F +  A E  +G    +  +  L A
Sbjct: 21  NMSVIAHVDHGKSTLTDSLVQKAGIISAAKAGDARFMDTRADEQERGVTIKSTAI-SLFA 79

Query: 184 ERERRYHNRYCSLEVRN*QVLCYHIDAPGHRDFIKNMITGTSQADCAVLIV 336
           E       +           L   ID+PGH DF   +       D A+++V
Sbjct: 80  EMTDD-DMKDMKEPADGTDFLVNLIDSPGHVDFSSEVTAALRVTDGALVVV 129


>SPAC323.04 |||mitochondrial ATPase |Schizosaccharomyces pombe|chr
           1|||Manual
          Length = 487

 Score = 28.7 bits (61), Expect = 0.87
 Identities = 15/41 (36%), Positives = 25/41 (60%), Gaps = 1/41 (2%)
 Frame = +2

Query: 446 TKWIPLNHHTVSPDLRKSRRKILI-HQEDWLQPSCCRFRAH 565
           TK++ + H+ ++  L  S+  ++I H ED L P+C   RAH
Sbjct: 438 TKYVHMAHNYLNEKLSPSQAMVIISHYEDEL-PACVNRRAH 477


>SPAC56F8.03 |||translation initiation factor IF2
           |Schizosaccharomyces pombe|chr 1|||Manual
          Length = 1079

 Score = 27.9 bits (59), Expect = 1.5
 Identities = 11/27 (40%), Positives = 15/27 (55%)
 Frame = +1

Query: 256 IDAPGHRDFIKNMITGTSQADCAVLIV 336
           ID PGH  F      GTS  + A+L++
Sbjct: 554 IDTPGHESFTNLRSRGTSLCNIAILVI 580


>SPAC1952.11c |ure2||urease |Schizosaccharomyces pombe|chr
           1|||Manual
          Length = 835

 Score = 27.9 bits (59), Expect = 1.5
 Identities = 15/45 (33%), Positives = 19/45 (42%)
 Frame = -2

Query: 706 AAGGRMASRASMRHFPSALPSLRSTCHPLNQGILVEGSNMLSPCH 572
           A GG      S+   P+ LPS  +   P     L E  +ML  CH
Sbjct: 546 AGGGHAPDIISLVQNPNILPSSTNPTRPFTTNTLDEELDMLMVCH 590


>SPBC1271.15c |||translation initiation factor
           IF-2Mt|Schizosaccharomyces pombe|chr 2|||Manual
          Length = 686

 Score = 27.1 bits (57), Expect = 2.7
 Identities = 13/32 (40%), Positives = 16/32 (50%)
 Frame = +1

Query: 256 IDAPGHRDFIKNMITGTSQADCAVLIVAAGTG 351
           +D PGH  F      G + AD  VL+VA   G
Sbjct: 225 LDTPGHMAFEAMRKRGANIADIVVLVVAGDDG 256


>SPBC215.12 |cwf10|spef2, snu114|GTPase Cwf10 |Schizosaccharomyces
           pombe|chr 2|||Manual
          Length = 983

 Score = 26.6 bits (56), Expect = 3.5
 Identities = 11/27 (40%), Positives = 16/27 (59%)
 Frame = +1

Query: 256 IDAPGHRDFIKNMITGTSQADCAVLIV 336
           ID PGH DF+  +    + +D  VL+V
Sbjct: 214 IDTPGHVDFVDEVAAPMAISDGVVLVV 240


>SPBC1703.06 |pof10||F-box protein Pof10|Schizosaccharomyces
           pombe|chr 2|||Manual
          Length = 662

 Score = 25.8 bits (54), Expect = 6.1
 Identities = 15/43 (34%), Positives = 20/43 (46%)
 Frame = -2

Query: 175 VCPIPKHI*RILYPFPGPPSRTSRWYVCQYHHICRSNDQWWWT 47
           V  +PK I  I++ F  P S  S    C+Y     S+D  W T
Sbjct: 31  VLNLPKEILIIIFSFLDPRSLLSAQCTCKYWKKLLSDDLSWRT 73


>SPCC1840.03 |sal3|pse1|karyopherin Sal3|Schizosaccharomyces
           pombe|chr 3|||Manual
          Length = 1095

 Score = 25.4 bits (53), Expect = 8.1
 Identities = 14/45 (31%), Positives = 22/45 (48%), Gaps = 1/45 (2%)
 Frame = +1

Query: 493 EIKKE-DPHTSRRLATTQLLSLSCPFLDGTETTCWSLQPKCLGSR 624
           E+K + DP+ +  L +  L  L   F DG  + C    P+ L +R
Sbjct: 693 ELKADFDPYVNEVLTSVVLPGLKFFFHDGVRSACCKCIPQLLNAR 737


>SPCC1450.11c |cek1||serine/threonine protein kinase
           Cek1|Schizosaccharomyces pombe|chr 3|||Manual
          Length = 1338

 Score = 25.4 bits (53), Expect = 8.1
 Identities = 8/33 (24%), Positives = 22/33 (66%)
 Frame = +1

Query: 442 VNKMDSTEPPYSEPRFEEIKKEDPHTSRRLATT 540
           +++  +++  +S+PRF+++K   P++S R   +
Sbjct: 503 LHRRKASDSNFSDPRFDDLKYLSPNSSPRFVAS 535


  Database: spombe
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 2,362,478
  Number of sequences in database:  5004
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 3,072,890
Number of Sequences: 5004
Number of extensions: 65976
Number of successful extensions: 241
Number of sequences better than 10.0: 19
Number of HSP's better than 10.0 without gapping: 213
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 231
length of database: 2,362,478
effective HSP length: 71
effective length of database: 2,007,194
effective search space used: 333194204
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -