SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS20026
         (735 letters)

Database: spombe 
           5004 sequences; 2,362,478 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SPCC794.09c |ef1a-a||translation elongation factor EF-1 alpha Ef...   213   3e-56
SPAC23A1.10 |ef1a-b||translation elongation factor EF-1 alpha Ef...   212   4e-56
SPBC839.15c |ef1a-c||translation elongation factor EF-1 alpha Ef...   212   4e-56
SPCC584.04 |sup35|erf3|translation release factor eRF3 |Schizosa...   119   4e-28
SPBC25B2.01 ||SPBC2G5.08|elongation factor 1 alpha related prote...   103   3e-23
SPBC9B6.04c |tuf1||mitochondrial translation elongation factor E...    65   1e-11
SPCP31B10.07 |eft202||translation elongation factor 2 |Schizosac...    41   2e-04
SPAC513.01c |eft201|eft2-1, etf2, SPAPYUK71.04c|translation elon...    41   2e-04
SPBC660.10 |||translation elongation factor G|Schizosaccharomyce...    40   4e-04
SPAC1B3.04c |||mitochondrial GTPase Guf1 |Schizosaccharomyces po...    35   0.010
SPBC1306.01c ||SPBC409.22c|translation elongation factor G|Schiz...    35   0.014
SPBC1271.15c |||translation initiation factor IF-2Mt|Schizosacch...    34   0.024
SPBC17G9.09 |tif213||translation initiation factor eIF2 gamma su...    31   0.17 
SPCC553.08c |||GTPase Ria1 |Schizosaccharomyces pombe|chr 3|||Ma...    30   0.30 
SPAC56F8.03 |||translation initiation factor IF2 |Schizosaccharo...    29   0.52 
SPAC1B3.13 |||U3 snoRNP-associated protein Nan1|Schizosaccharomy...    28   1.2  
SPAC15F9.02 |seh1||nucleoporin Seh1 |Schizosaccharomyces pombe|c...    27   2.1  
SPBC1703.13c |||inorganic phosphate transporter |Schizosaccharom...    27   2.1  
SPBC215.12 |cwf10|spef2, snu114|GTPase Cwf10 |Schizosaccharomyce...    27   2.8  
SPAC9G1.11c |spn4||septin Spn4|Schizosaccharomyces pombe|chr 1||...    26   4.8  
SPBC24C6.08c |||vesicle coat protein|Schizosaccharomyces pombe|c...    25   8.5  

>SPCC794.09c |ef1a-a||translation elongation factor EF-1 alpha
           Ef1a-a |Schizosaccharomyces pombe|chr 3|||Manual
          Length = 460

 Score =  213 bits (519), Expect = 3e-56
 Identities = 103/133 (77%), Positives = 108/133 (81%)
 Frame = +1

Query: 112 MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEWVKDPSNMLGYW 291
           MGKEK HIN+VVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEA E  K         
Sbjct: 1   MGKEKGHINVVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEATELGKGSFKYAWVL 60

Query: 292 TN*RLSVSVGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGT 471
              +     GITIDIALWKFET KY VT+IDAPGHRDFIKNMITGTSQADCAVLI+  GT
Sbjct: 61  DKLKAERERGITIDIALWKFETPKYNVTVIDAPGHRDFIKNMITGTSQADCAVLIIGGGT 120

Query: 472 GEFEAGISKNGQT 510
           GEFEAGISK+GQT
Sbjct: 121 GEFEAGISKDGQT 133



 Score =  109 bits (263), Expect = 3e-25
 Identities = 51/75 (68%), Positives = 63/75 (84%)
 Frame = +3

Query: 510 REHALLAFTLGVKQLIVGVNKMDSTEPPYSEPRFEEIKKEVSSYIKKIGYNPAAVAFVPI 689
           REHALLA+TLGVKQLIV VNKMD+T   +S+ RFEEI KE S++IKK+G+NP  V FVP+
Sbjct: 134 REHALLAYTLGVKQLIVAVNKMDTTG--WSQARFEEIVKETSNFIKKVGFNPKTVPFVPV 191

Query: 690 SGWHGDNMLEPSTKM 734
           SG+ GDNM+EP+T M
Sbjct: 192 SGFQGDNMIEPTTNM 206


>SPAC23A1.10 |ef1a-b||translation elongation factor EF-1 alpha
           Ef1a-b |Schizosaccharomyces pombe|chr 1|||Manual
          Length = 460

 Score =  212 bits (518), Expect = 4e-56
 Identities = 102/133 (76%), Positives = 108/133 (81%)
 Frame = +1

Query: 112 MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEWVKDPSNMLGYW 291
           MGKEK HIN+VVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEA E  K         
Sbjct: 1   MGKEKGHINVVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEATELGKGSFKYAWVL 60

Query: 292 TN*RLSVSVGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGT 471
              +     GITIDIALWKFET KY VT+IDAPGHRDFIKNMITGTSQADCA+LI+  GT
Sbjct: 61  DKLKAERERGITIDIALWKFETPKYNVTVIDAPGHRDFIKNMITGTSQADCAILIIGGGT 120

Query: 472 GEFEAGISKNGQT 510
           GEFEAGISK+GQT
Sbjct: 121 GEFEAGISKDGQT 133



 Score =  109 bits (263), Expect = 3e-25
 Identities = 51/75 (68%), Positives = 63/75 (84%)
 Frame = +3

Query: 510 REHALLAFTLGVKQLIVGVNKMDSTEPPYSEPRFEEIKKEVSSYIKKIGYNPAAVAFVPI 689
           REHALLA+TLGVKQLIV VNKMD+T   +S+ RFEEI KE S++IKK+G+NP  V FVP+
Sbjct: 134 REHALLAYTLGVKQLIVAVNKMDTTG--WSQARFEEIVKETSNFIKKVGFNPKTVPFVPV 191

Query: 690 SGWHGDNMLEPSTKM 734
           SG+ GDNM+EP+T M
Sbjct: 192 SGFQGDNMIEPTTNM 206


>SPBC839.15c |ef1a-c||translation elongation factor EF-1 alpha
           Ef1a-c |Schizosaccharomyces pombe|chr 2|||Manual
          Length = 460

 Score =  212 bits (518), Expect = 4e-56
 Identities = 102/133 (76%), Positives = 108/133 (81%)
 Frame = +1

Query: 112 MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEWVKDPSNMLGYW 291
           MGKEK HIN+VVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEA E  K         
Sbjct: 1   MGKEKGHINVVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEATELGKGSFKYAWVL 60

Query: 292 TN*RLSVSVGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGT 471
              +     GITIDIALWKFET KY VT+IDAPGHRDFIKNMITGTSQADCA+LI+  GT
Sbjct: 61  DKLKAERERGITIDIALWKFETPKYNVTVIDAPGHRDFIKNMITGTSQADCAILIIGGGT 120

Query: 472 GEFEAGISKNGQT 510
           GEFEAGISK+GQT
Sbjct: 121 GEFEAGISKDGQT 133



 Score =  109 bits (263), Expect = 3e-25
 Identities = 51/75 (68%), Positives = 63/75 (84%)
 Frame = +3

Query: 510 REHALLAFTLGVKQLIVGVNKMDSTEPPYSEPRFEEIKKEVSSYIKKIGYNPAAVAFVPI 689
           REHALLA+TLGVKQLIV VNKMD+T   +S+ RFEEI KE S++IKK+G+NP  V FVP+
Sbjct: 134 REHALLAYTLGVKQLIVAVNKMDTTG--WSQARFEEIVKETSNFIKKVGFNPKTVPFVPV 191

Query: 690 SGWHGDNMLEPSTKM 734
           SG+ GDNM+EP+T M
Sbjct: 192 SGFQGDNMIEPTTNM 206


>SPCC584.04 |sup35|erf3|translation release factor eRF3
           |Schizosaccharomyces pombe|chr 3|||Manual
          Length = 662

 Score =  119 bits (287), Expect = 4e-28
 Identities = 57/129 (44%), Positives = 83/129 (64%)
 Frame = +1

Query: 124 KTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEWVKDPSNMLGYWTN*R 303
           K H+NIV IGHVD+GKST  G++++  G +DKRT+EK E+EA+E  K+   +     +  
Sbjct: 236 KEHVNIVFIGHVDAGKSTLGGNILFLTGMVDKRTMEKIEREAKEAGKESWYLSWALDSTS 295

Query: 304 LSVSVGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFE 483
                G T+++    FET     +++DAPGH+ ++ NMI G SQAD  VL+++A  GEFE
Sbjct: 296 EEREKGKTVEVGRAYFETEHRRFSLLDAPGHKGYVTNMINGASQADIGVLVISARRGEFE 355

Query: 484 AGISKNGQT 510
           AG  + GQT
Sbjct: 356 AGFERGGQT 364



 Score = 58.4 bits (135), Expect = 1e-09
 Identities = 27/70 (38%), Positives = 46/70 (65%), Gaps = 2/70 (2%)
 Frame = +3

Query: 510 REHALLAFTLGVKQLIVGVNKMDSTEPPYSEPRFEEIKKEVSSYIKKI-GYNPAA-VAFV 683
           REHA+LA T G+  L+V +NKMD     +SE R++E   ++S +++++ GYN    V ++
Sbjct: 365 REHAVLARTQGINHLVVVINKMDEPSVQWSEERYKECVDKLSMFLRRVAGYNSKTDVKYM 424

Query: 684 PISGWHGDNM 713
           P+S + G N+
Sbjct: 425 PVSAYTGQNV 434


>SPBC25B2.01 ||SPBC2G5.08|elongation factor 1 alpha related
           protein|Schizosaccharomyces pombe|chr 2|||Manual
          Length = 592

 Score =  103 bits (247), Expect = 3e-23
 Identities = 54/129 (41%), Positives = 74/129 (57%)
 Frame = +1

Query: 124 KTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEWVKDPSNMLGYWTN*R 303
           K  +++VV GHVDSGKST  G ++++ G I+ R+++K   EA    K   +         
Sbjct: 175 KPVVHLVVTGHVDSGKSTMLGRIMFELGEINSRSMQKLHNEAANSGKGSFSYAWLLDTTE 234

Query: 304 LSVSVGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFE 483
              + G+T+D+A   FE+ K    I DAPGHRDFI  MI G S AD AVL+V +    FE
Sbjct: 235 EERARGVTMDVASTTFESDKKIYEIGDAPGHRDFISGMIAGASSADFAVLVVDSSQNNFE 294

Query: 484 AGISKNGQT 510
            G  +NGQT
Sbjct: 295 RGFLENGQT 303



 Score = 66.9 bits (156), Expect = 3e-12
 Identities = 49/155 (31%), Positives = 70/155 (45%), Gaps = 1/155 (0%)
 Frame = +3

Query: 258 GKGSFKYAWVLDKLKAERERRYHNRYCSLEVRN*QVLCYHH*CSWTQRFHQEHDHRNLSG 437
           GKGSF YAW+LD  + ER R       S    + + +         + F         S 
Sbjct: 220 GKGSFSYAWLLDTTEEERARGVTMDVASTTFESDKKIYEIGDAPGHRDFISGMIAGASSA 279

Query: 438 *LRCAHRSCRYR*IRSWYL*ERSNREHALLAFTLGVKQLIVGVNKMDSTEPPYSEPRFEE 617
                            +L     REHA L   LG+ +++V VNK+D     +SE RF+E
Sbjct: 280 DFAVLVVDSSQNNFERGFLENGQTREHAYLLRALGISEIVVSVNKLDLMS--WSEDRFQE 337

Query: 618 IKKEVSSY-IKKIGYNPAAVAFVPISGWHGDNMLE 719
           IK  VS + IK +G+  + V FVPIS   G N+++
Sbjct: 338 IKNIVSDFLIKMVGFKTSNVHFVPISAISGTNLIQ 372


>SPBC9B6.04c |tuf1||mitochondrial translation elongation factor
           EF-Tu Tuf1 |Schizosaccharomyces pombe|chr 2|||Manual
          Length = 439

 Score = 64.9 bits (151), Expect = 1e-11
 Identities = 43/124 (34%), Positives = 63/124 (50%), Gaps = 4/124 (3%)
 Frame = +1

Query: 118 KEKTHINIVVIGHVDSGKSTTTGHLIYKC----GGIDKRTIEKFEKEAQEWVKDPSNMLG 285
           ++K H+NI  IGHVD GK+T T   I KC    G        + +K  +E  +       
Sbjct: 49  RKKPHVNIGTIGHVDHGKTTLTA-AITKCLSDLGQASFMDYSQIDKAPEEKAR------- 100

Query: 286 YWTN*RLSVSVGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAA 465
                      GITI  A  ++ET+  +   +D PGH D+IKNMITG +  D A+++V+A
Sbjct: 101 -----------GITISSAHVEYETANRHYAHVDCPGHADYIKNMITGAATMDGAIIVVSA 149

Query: 466 GTGE 477
             G+
Sbjct: 150 TDGQ 153



 Score = 41.1 bits (92), Expect = 2e-04
 Identities = 20/44 (45%), Positives = 29/44 (65%)
 Frame = +3

Query: 510 REHALLAFTLGVKQLIVGVNKMDSTEPPYSEPRFEEIKKEVSSY 641
           REH LLA  +GVKQ++V +NK+D  EP   E    E+++ +S Y
Sbjct: 158 REHLLLARQVGVKQIVVYINKVDMVEPDMIELVEMEMRELLSEY 201


>SPCP31B10.07 |eft202||translation elongation factor 2
           |Schizosaccharomyces pombe|chr 3|||Manual
          Length = 842

 Score = 41.1 bits (92), Expect = 2e-04
 Identities = 34/122 (27%), Positives = 51/122 (41%), Gaps = 6/122 (4%)
 Frame = +1

Query: 112 MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGI------DKRTIEKFEKEAQEWVKDPS 273
           MGK     N+ VI HVD GKST T  L+ K G I      D R ++    E +  V   S
Sbjct: 13  MGKPSNVRNMSVIAHVDHGKSTLTDSLVQKAGIISAAKAGDARFMDTRADEQERGVTIKS 72

Query: 274 NMLGYWTN*RLSVSVGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVL 453
             +  +            +       + + + V +ID+PGH DF   +       D A++
Sbjct: 73  TAISLFAE-----MTDDDMKDMKEPADGTDFLVNLIDSPGHVDFSSEVTAALRVTDGALV 127

Query: 454 IV 459
           +V
Sbjct: 128 VV 129


>SPAC513.01c |eft201|eft2-1, etf2, SPAPYUK71.04c|translation
           elongation factor 2 |Schizosaccharomyces pombe|chr
           1|||Manual
          Length = 842

 Score = 41.1 bits (92), Expect = 2e-04
 Identities = 34/122 (27%), Positives = 51/122 (41%), Gaps = 6/122 (4%)
 Frame = +1

Query: 112 MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGI------DKRTIEKFEKEAQEWVKDPS 273
           MGK     N+ VI HVD GKST T  L+ K G I      D R ++    E +  V   S
Sbjct: 13  MGKPSNVRNMSVIAHVDHGKSTLTDSLVQKAGIISAAKAGDARFMDTRADEQERGVTIKS 72

Query: 274 NMLGYWTN*RLSVSVGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVL 453
             +  +            +       + + + V +ID+PGH DF   +       D A++
Sbjct: 73  TAISLFAE-----MTDDDMKDMKEPADGTDFLVNLIDSPGHVDFSSEVTAALRVTDGALV 127

Query: 454 IV 459
           +V
Sbjct: 128 VV 129


>SPBC660.10 |||translation elongation factor G|Schizosaccharomyces
           pombe|chr 2|||Manual
          Length = 813

 Score = 39.9 bits (89), Expect = 4e-04
 Identities = 33/113 (29%), Positives = 48/113 (42%)
 Frame = +1

Query: 136 NIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEWVKDPSNMLGYWTN*RLSVS 315
           N+ +I H+D+GK+T T  ++Y  GG        F       V     ++ Y    R    
Sbjct: 30  NVGIIAHIDAGKTTLTEKMLYY-GGFTSH----FGN-----VDTGDTVMDYLPAERQR-- 77

Query: 316 VGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTG 474
            GITI+ A   F      + +ID PGH DF   +    +  D AV I+    G
Sbjct: 78  -GITINSAAISFTWRNQRINLIDTPGHADFTFEVERSVAVLDGAVAIIDGSAG 129


>SPAC1B3.04c |||mitochondrial GTPase Guf1 |Schizosaccharomyces
           pombe|chr 1|||Manual
          Length = 646

 Score = 35.1 bits (77), Expect = 0.010
 Identities = 26/113 (23%), Positives = 47/113 (41%)
 Frame = +1

Query: 136 NIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEWVKDPSNMLGYWTN*RLSVS 315
           N  VI H+D GKST +  ++   G I++        +  E  +            R  ++
Sbjct: 60  NWAVIAHIDHGKSTLSDCILKLTGVINEHNFRNQFLDKLEVER------------RRGIT 107

Query: 316 VGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTG 474
           V       ++ +    Y + +ID PGH DF   ++   +  +  +L+V A  G
Sbjct: 108 VKAQTCSMIYYYHGQSYLLNLIDTPGHVDFRAEVMHSLAACEGCILLVDASQG 160


>SPBC1306.01c ||SPBC409.22c|translation elongation factor
           G|Schizosaccharomyces pombe|chr 2|||Manual
          Length = 770

 Score = 34.7 bits (76), Expect = 0.014
 Identities = 41/132 (31%), Positives = 55/132 (41%), Gaps = 19/132 (14%)
 Frame = +1

Query: 136 NIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEWVKDPSNMLGYWTN*RLSVS 315
           NI +  H+DSGK+T T  ++Y  G I         K+  E V+   N+        L   
Sbjct: 61  NIGISAHIDSGKTTFTERVLYYTGRI---------KDIHE-VRGKDNVGAKMDFMELERE 110

Query: 316 VGITIDIAL----WK---------------FETSKYYVTIIDAPGHRDFIKNMITGTSQA 438
            GITI  A     W+               FE S Y + IID PGH DF   +       
Sbjct: 111 KGITIQSAATHCTWERTVDQIEANEKQKTDFEKS-YNINIIDTPGHIDFTIEVERALRVL 169

Query: 439 DCAVLIVAAGTG 474
           D AVL++ A +G
Sbjct: 170 DGAVLVLCAVSG 181


>SPBC1271.15c |||translation initiation factor
           IF-2Mt|Schizosaccharomyces pombe|chr 2|||Manual
          Length = 686

 Score = 33.9 bits (74), Expect = 0.024
 Identities = 19/54 (35%), Positives = 26/54 (48%), Gaps = 2/54 (3%)
 Frame = +1

Query: 319 GITIDIALWK--FETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTG 474
           GIT  I  +   F+    ++T +D PGH  F      G + AD  VL+VA   G
Sbjct: 203 GITQKIGAFTVPFDKGSKFITFLDTPGHMAFEAMRKRGANIADIVVLVVAGDDG 256


>SPBC17G9.09 |tif213||translation initiation factor eIF2 gamma
           subunit|Schizosaccharomyces pombe|chr 2|||Manual
          Length = 446

 Score = 31.1 bits (67), Expect = 0.17
 Identities = 11/32 (34%), Positives = 20/32 (62%)
 Frame = +1

Query: 367 YVTIIDAPGHRDFIKNMITGTSQADCAVLIVA 462
           +V+ +D PGH   +  M+ G +  D A+L++A
Sbjct: 109 HVSFVDCPGHDILMATMLNGAAVMDAALLLIA 140


>SPCC553.08c |||GTPase Ria1 |Schizosaccharomyces pombe|chr
           3|||Manual
          Length = 1000

 Score = 30.3 bits (65), Expect = 0.30
 Identities = 13/37 (35%), Positives = 21/37 (56%)
 Frame = +1

Query: 364 YYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTG 474
           Y + +ID+PGH DF   + + +   D A ++V A  G
Sbjct: 94  YLINLIDSPGHVDFSSEVSSASRLCDGAFVLVDAVEG 130


>SPAC56F8.03 |||translation initiation factor IF2
           |Schizosaccharomyces pombe|chr 1|||Manual
          Length = 1079

 Score = 29.5 bits (63), Expect = 0.52
 Identities = 12/28 (42%), Positives = 16/28 (57%)
 Frame = +1

Query: 376 IIDAPGHRDFIKNMITGTSQADCAVLIV 459
           IID PGH  F      GTS  + A+L++
Sbjct: 553 IIDTPGHESFTNLRSRGTSLCNIAILVI 580


>SPAC1B3.13 |||U3 snoRNP-associated protein Nan1|Schizosaccharomyces
           pombe|chr 1|||Manual
          Length = 800

 Score = 28.3 bits (60), Expect = 1.2
 Identities = 15/44 (34%), Positives = 21/44 (47%)
 Frame = +1

Query: 229 EKFEKEAQEWVKDPSNMLGYWTN*RLSVSVGITIDIALWKFETS 360
           EKF  +   W  +P N L +  N    +S G    + LW+ ETS
Sbjct: 251 EKFNPQILHWHANPLNGLSWALNGEYLLSGGQEGVLVLWQMETS 294


>SPAC15F9.02 |seh1||nucleoporin Seh1 |Schizosaccharomyces pombe|chr
           1|||Manual
          Length = 339

 Score = 27.5 bits (58), Expect = 2.1
 Identities = 13/52 (25%), Positives = 24/52 (46%)
 Frame = +1

Query: 310 VSVGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAA 465
           ++VG   D  ++K  +   +  + + PGH D I+++    S      LI  A
Sbjct: 186 IAVGCMNDAYIYKQNSHGKWKKVAELPGHTDLIRDICWAPSMGSSYYLIATA 237


>SPBC1703.13c |||inorganic phosphate transporter
           |Schizosaccharomyces pombe|chr 2|||Manual
          Length = 311

 Score = 27.5 bits (58), Expect = 2.1
 Identities = 10/26 (38%), Positives = 15/26 (57%)
 Frame = -3

Query: 274 LKDPLPIPGPPSRTSRWYVCQYHHIC 197
           +  PL  P PP +T + Y  QY+ +C
Sbjct: 1   MSTPLIPPAPPKKTLQLYTPQYYGLC 26


>SPBC215.12 |cwf10|spef2, snu114|GTPase Cwf10 |Schizosaccharomyces
           pombe|chr 2|||Manual
          Length = 983

 Score = 27.1 bits (57), Expect = 2.8
 Identities = 15/49 (30%), Positives = 26/49 (53%)
 Frame = +1

Query: 313 SVGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIV 459
           S  +T+ ++  K +T  +    ID PGH DF+  +    + +D  VL+V
Sbjct: 194 STPLTLAVSDMKGKTFAFQC--IDTPGHVDFVDEVAAPMAISDGVVLVV 240


>SPAC9G1.11c |spn4||septin Spn4|Schizosaccharomyces pombe|chr
           1|||Manual
          Length = 380

 Score = 26.2 bits (55), Expect = 4.8
 Identities = 12/33 (36%), Positives = 19/33 (57%), Gaps = 2/33 (6%)
 Frame = +1

Query: 322 ITIDIALWKFETSKYYV--TIIDAPGHRDFIKN 414
           + I+I   + E   +++  T+ID PG  DFI N
Sbjct: 71  VEIEITKAELEEKNFHLRLTVIDTPGFGDFINN 103


>SPBC24C6.08c |||vesicle coat protein|Schizosaccharomyces pombe|chr
           2|||Manual
          Length = 367

 Score = 25.4 bits (53), Expect = 8.5
 Identities = 9/30 (30%), Positives = 18/30 (60%)
 Frame = +1

Query: 595 TVSPDLRKSRRKYPHTSRRLATTQLLSLSC 684
           + +PD+     ++PHT +R +T + L + C
Sbjct: 145 STNPDVLYMSSQHPHTQQRYSTLKRLMVRC 174


  Database: spombe
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 2,362,478
  Number of sequences in database:  5004
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 3,067,998
Number of Sequences: 5004
Number of extensions: 62839
Number of successful extensions: 249
Number of sequences better than 10.0: 21
Number of HSP's better than 10.0 without gapping: 208
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 234
length of database: 2,362,478
effective HSP length: 71
effective length of database: 2,007,194
effective search space used: 347244562
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -