SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS20025
         (696 letters)

Database: spombe 
           5004 sequences; 2,362,478 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SPBC14C8.06 |arc1|sop2|ARP2/3 actin-organizing complex subunit S...    29   0.48 
SPCC11E10.05c |ynd1||nucleoside diphosphatase |Schizosaccharomyc...    28   1.1  
SPAC22G7.10 |||mRNA cleavage and polyadenylation specificity fac...    27   1.9  
SPAC1834.08 |mak1|phk3|histidine kinase Mak1|Schizosaccharomyces...    27   3.4  
SPCC663.15c |||conserved fungal protein|Schizosaccharomyces pomb...    27   3.4  
SPAC4A8.11c |fas2|lsd1|fatty acid synthase alpha subunit Lsd1 |S...    26   4.5  
SPBP4G3.03 |||PI31 proteasome regulator related|Schizosaccharomy...    25   7.8  
SPAC1687.12c |coq4||ubiquinone biosynthesis protein Coq4|Schizos...    25   7.8  

>SPBC14C8.06 |arc1|sop2|ARP2/3 actin-organizing complex subunit
           Sop2|Schizosaccharomyces pombe|chr 2|||Manual
          Length = 377

 Score = 29.5 bits (63), Expect = 0.48
 Identities = 13/26 (50%), Positives = 17/26 (65%)
 Frame = -3

Query: 592 NSQRSQCDTTSKTNTHQLYRQDKLRW 515
           NSQR++  TT+ TN  +LY QD   W
Sbjct: 20  NSQRTEFVTTTATNQVELYEQDGNGW 45


>SPCC11E10.05c |ynd1||nucleoside diphosphatase |Schizosaccharomyces
           pombe|chr 3|||Manual
          Length = 572

 Score = 28.3 bits (60), Expect = 1.1
 Identities = 19/70 (27%), Positives = 29/70 (41%), Gaps = 2/70 (2%)
 Frame = +3

Query: 162 VKKEALYHLSAVFSVAIFAVDAVGEVLAQ*IRRVPPSASAQFPGGAG--RTKSGSAPKWP 335
           V KE    LSA   + +  VDA  ++L+   R +  +     P  +   R   G A    
Sbjct: 89  VHKETPVFLSATAGMRLLGVDAQNKILSHACRYIKKNYDFDIPNCSNSIRVIDGKAEGMY 148

Query: 336 GWRCLSYNIK 365
           GW   +Y +K
Sbjct: 149 GWLATNYLLK 158


>SPAC22G7.10 |||mRNA cleavage and polyadenylation specificity factor
           complex subunit, Fip1 homolog |Schizosaccharomyces
           pombe|chr 1|||Manual
          Length = 344

 Score = 27.5 bits (58), Expect = 1.9
 Identities = 15/42 (35%), Positives = 23/42 (54%)
 Frame = -3

Query: 313 DFVLPAPPGNCADALGGTLLIHWARTSPTASTAKIATEKTAL 188
           +F++   PG  A+ LGG++    A    T  +AK   EKTA+
Sbjct: 49  EFIIETKPGERAEPLGGSI----ATLGSTRPSAKPQVEKTAV 86


>SPAC1834.08 |mak1|phk3|histidine kinase Mak1|Schizosaccharomyces
            pombe|chr 1|||Manual
          Length = 1639

 Score = 26.6 bits (56), Expect = 3.4
 Identities = 15/52 (28%), Positives = 26/52 (50%)
 Frame = +1

Query: 391  SNKPVGTTIETTTNESQA*TSRGRYVWHIIYVVHVDSSCAHSTSTCLVCTTD 546
            +N+      +T   E +  ++ G Y WH++  V V++S   ST+  L   TD
Sbjct: 918  NNQDESNGTKTFAAEIRFRSTDGHYRWHLVKSVCVNNSADTSTNLWLGTCTD 969


>SPCC663.15c |||conserved fungal protein|Schizosaccharomyces
           pombe|chr 3|||Manual
          Length = 657

 Score = 26.6 bits (56), Expect = 3.4
 Identities = 16/40 (40%), Positives = 20/40 (50%)
 Frame = +3

Query: 66  KVADEAVKELHAEED*DVVDPRPTKGVHKEMRVKKEALYH 185
           +V D A +  H+E +    DP   KGVH  MR    AL H
Sbjct: 385 EVPDTASETEHSEIEDFHFDPYSEKGVHIAMRYFDAALTH 424


>SPAC4A8.11c |fas2|lsd1|fatty acid synthase alpha subunit Lsd1
           |Schizosaccharomyces pombe|chr 1|||Manual
          Length = 1842

 Score = 26.2 bits (55), Expect = 4.5
 Identities = 9/31 (29%), Positives = 18/31 (58%)
 Frame = -3

Query: 223 STAKIATEKTALRWYNASFLTLISLCTPLVG 131
           S +K+  E    RWY+ S+   +++C  ++G
Sbjct: 798 SESKLGLETLFNRWYSESWANYLTICGAVIG 828


>SPBP4G3.03 |||PI31 proteasome regulator related|Schizosaccharomyces
           pombe|chr 2|||Manual
          Length = 241

 Score = 25.4 bits (53), Expect = 7.8
 Identities = 12/23 (52%), Positives = 14/23 (60%), Gaps = 1/23 (4%)
 Frame = -2

Query: 281 RGRTRRNPPYSLGQDLPHGV-HR 216
           R    +NP   L QDLPHG+ HR
Sbjct: 146 RSEFPKNPHAFLAQDLPHGLPHR 168


>SPAC1687.12c |coq4||ubiquinone biosynthesis protein
           Coq4|Schizosaccharomyces pombe|chr 1|||Manual
          Length = 272

 Score = 25.4 bits (53), Expect = 7.8
 Identities = 9/34 (26%), Positives = 19/34 (55%)
 Frame = +2

Query: 566 CIALRSLRILYLYWNVRSGVSNLELHRYHWIKDV 667
           C      R +Y+ W++R+G++   L   +W K++
Sbjct: 219 CEQASRFRRVYIPWSIRNGLNAKTLINVYWEKEL 252


  Database: spombe
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 2,362,478
  Number of sequences in database:  5004
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 2,536,680
Number of Sequences: 5004
Number of extensions: 48479
Number of successful extensions: 134
Number of sequences better than 10.0: 8
Number of HSP's better than 10.0 without gapping: 132
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 134
length of database: 2,362,478
effective HSP length: 71
effective length of database: 2,007,194
effective search space used: 321151040
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -