SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS20024
         (560 letters)

Database: spombe 
           5004 sequences; 2,362,478 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SPAC17A5.16 |||human down-regulated in multiple cancers-1 homolo...    28   1.1  
SPAC3H1.10 |||phytochelatin synthetase |Schizosaccharomyces pomb...    27   1.4  
SPCC1183.11 ||SPCC31H12.01|MS ion channel protein 1|Schizosaccha...    26   3.3  
SPAC19G12.14 |its3||1-phosphatidylinositol-4-phosphate 5-kinase ...    26   4.4  
SPBC15D4.03 |slm9||hira protein Slm9|Schizosaccharomyces pombe|c...    25   7.6  
SPBC23E6.01c ||SPBPJ758.01|RNA-binding protein, rrm type|Schizos...    25   7.6  
SPBP19A11.02c |||sequence orphan|Schizosaccharomyces pombe|chr 2...    25   7.6  
SPBP8B7.17c |||phosphomethylpyrimidine kinase|Schizosaccharomyce...    25   7.6  
SPACUNK4.07c |cta4|sev4, SPAPYUK71.01|P-type ATPase, calcium tra...    25   7.6  

>SPAC17A5.16 |||human down-regulated in multiple cancers-1 homolog
           3|Schizosaccharomyces pombe|chr 1|||Manual
          Length = 925

 Score = 27.9 bits (59), Expect = 1.1
 Identities = 12/30 (40%), Positives = 17/30 (56%)
 Frame = -1

Query: 341 HCCRLLSETIPGLE*MLNIITRHRIIWWYL 252
           +C RLL+  IP L   L++   H+  WW L
Sbjct: 96  NCIRLLTRIIPFLNEKLDLEEWHQKFWWSL 125


>SPAC3H1.10 |||phytochelatin synthetase |Schizosaccharomyces
           pombe|chr 1|||Manual
          Length = 414

 Score = 27.5 bits (58), Expect = 1.4
 Identities = 9/18 (50%), Positives = 12/18 (66%)
 Frame = -1

Query: 371 SWCWRDSWVRHCCRLLSE 318
           SW W D ++  CCR LS+
Sbjct: 114 SWRWYDQYMLDCCRSLSD 131


>SPCC1183.11 ||SPCC31H12.01|MS ion channel protein
           1|Schizosaccharomyces pombe|chr 3|||Manual
          Length = 1011

 Score = 26.2 bits (55), Expect = 3.3
 Identities = 7/16 (43%), Positives = 13/16 (81%)
 Frame = -3

Query: 198 SLGWGIIWVSVWISRH 151
           ++ W IIW+S+W +R+
Sbjct: 273 AIWWEIIWLSIWAARY 288


>SPAC19G12.14 |its3||1-phosphatidylinositol-4-phosphate 5-kinase
           Its3|Schizosaccharomyces pombe|chr 1|||Manual
          Length = 742

 Score = 25.8 bits (54), Expect = 4.4
 Identities = 9/23 (39%), Positives = 13/23 (56%)
 Frame = -3

Query: 453 YHSSGLVSHKDSFDNQMHHVVSH 385
           +    L+SHK+ F+  M H V H
Sbjct: 40  FQKKDLISHKNDFERTMRHDVLH 62


>SPBC15D4.03 |slm9||hira protein Slm9|Schizosaccharomyces pombe|chr
           2|||Manual
          Length = 807

 Score = 25.0 bits (52), Expect = 7.6
 Identities = 11/31 (35%), Positives = 18/31 (58%)
 Frame = -1

Query: 518 PPLLLAKYRSILRSCRNPFNCCIIALGWCHI 426
           PP+++A     L  C + F CCI++ G  +I
Sbjct: 534 PPVVVAATPCFLECCGD-FLCCIVSTGLLYI 563


>SPBC23E6.01c ||SPBPJ758.01|RNA-binding protein, rrm
           type|Schizosaccharomyces pombe|chr 2|||Manual
          Length = 473

 Score = 25.0 bits (52), Expect = 7.6
 Identities = 15/51 (29%), Positives = 20/51 (39%)
 Frame = +3

Query: 297 SFQPGYSLGQQPAAMSYPGITPAPTAPRGHVTPHGAFGYQSYPYVTPTQSY 449
           S  P  SL  Q     YP + P+P A +    P G       P + P Q +
Sbjct: 399 SLFPAMSLPPQAQFSPYPAVAPSPLALQTRGAPIGMEISIGSPALVPDQMH 449


>SPBP19A11.02c |||sequence orphan|Schizosaccharomyces pombe|chr
           2|||Manual
          Length = 244

 Score = 25.0 bits (52), Expect = 7.6
 Identities = 15/40 (37%), Positives = 18/40 (45%)
 Frame = +3

Query: 429 VTPTQSYDTTIEWVPTTPQNASILSEKQWWLVMKVTMVVP 548
           V PT S +TT    PTT  N +  +      V   T VVP
Sbjct: 84  VPPTTSMNTTTTVPPTTSLNTTTTTAPPTTHVNSTTTVVP 123


>SPBP8B7.17c |||phosphomethylpyrimidine kinase|Schizosaccharomyces
           pombe|chr 2|||Manual
          Length = 506

 Score = 25.0 bits (52), Expect = 7.6
 Identities = 11/28 (39%), Positives = 18/28 (64%), Gaps = 1/28 (3%)
 Frame = -2

Query: 241 EVEHLQDCRAMGKLVLGVG-DNLGFRMD 161
           E+ HL+D +A+GK ++  G  N+  R D
Sbjct: 155 EIHHLEDVKAVGKKLIKAGCKNVVIRCD 182


>SPACUNK4.07c |cta4|sev4, SPAPYUK71.01|P-type ATPase, calcium
           transporting Cta4 |Schizosaccharomyces pombe|chr
           1|||Manual
          Length = 1211

 Score = 25.0 bits (52), Expect = 7.6
 Identities = 11/24 (45%), Positives = 16/24 (66%)
 Frame = +3

Query: 15  NK*RSISLRYLPNRKVGSLNSLFW 86
           NK  S  +RYL    VG++++LFW
Sbjct: 46  NKLYSEEVRYLTYIAVGTIHALFW 69


  Database: spombe
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 2,362,478
  Number of sequences in database:  5004
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 2,412,370
Number of Sequences: 5004
Number of extensions: 49789
Number of successful extensions: 131
Number of sequences better than 10.0: 9
Number of HSP's better than 10.0 without gapping: 126
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 130
length of database: 2,362,478
effective HSP length: 69
effective length of database: 2,017,202
effective search space used: 236012634
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -