SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS20019
         (587 letters)

Database: spombe 
           5004 sequences; 2,362,478 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SPBC365.15 |alp4||gamma tubulin complex Spc97/GCP2 subunit Alp4|...    29   0.50 
SPAC1F5.04c |cdc12||formin Cdc12|Schizosaccharomyces pombe|chr 1...    28   0.88 
SPCC794.08 |||HEAT repeat protein, unknown biological role|Schiz...    28   1.2  
SPBC106.08c |mug2||DUF1773 family protein 1|Schizosaccharomyces ...    27   1.5  
SPACUNK4.08 |||dipeptidyl aminopeptidase |Schizosaccharomyces po...    27   1.5  
SPBC16C6.02c |vps1302|vps13b|chorein homolog|Schizosaccharomyces...    27   2.7  
SPAC23G3.05c |||regulator of G-protein signaling |Schizosaccharo...    26   4.7  
SPBC146.11c |mug97|meu33|meiotically upregulated gene Mug97|Schi...    25   6.2  
SPBC16A3.03c |lyn1||sequence orphan|Schizosaccharomyces pombe|ch...    25   8.2  

>SPBC365.15 |alp4||gamma tubulin complex Spc97/GCP2 subunit
           Alp4|Schizosaccharomyces pombe|chr 2|||Manual
          Length = 784

 Score = 29.1 bits (62), Expect = 0.50
 Identities = 21/71 (29%), Positives = 38/71 (53%)
 Frame = -2

Query: 418 ESRINEKLALAPLWMESLFISCPLRQMILLRGASNIQMSRTNNASNRPLLSSVNFILGQQ 239
           +SRI+   +L  L + +L  S  LRQ+ L+     + M +  ++S+   LS+++ +L Q 
Sbjct: 174 QSRIDPNFSLQTLRLYTLPTSRSLRQVYLILRDLLLSMEKNASSSDDLGLSNIDDLLEQL 233

Query: 238 LEARDEAGKVN 206
            E  D +  VN
Sbjct: 234 NEGNDISHVVN 244


>SPAC1F5.04c |cdc12||formin Cdc12|Schizosaccharomyces pombe|chr
            1|||Manual
          Length = 1841

 Score = 28.3 bits (60), Expect = 0.88
 Identities = 11/33 (33%), Positives = 19/33 (57%)
 Frame = -1

Query: 380  LDGVSLHQLPIETDDTIKRSVKHTDESHEQCIE 282
            L G+  H+L  +  + I R + H D+S  +C+E
Sbjct: 1060 LFGIHFHKLSHKNPNEIIRMILHCDDSMNECVE 1092


>SPCC794.08 |||HEAT repeat protein, unknown biological
           role|Schizosaccharomyces pombe|chr 3|||Manual
          Length = 798

 Score = 27.9 bits (59), Expect = 1.2
 Identities = 14/49 (28%), Positives = 26/49 (53%)
 Frame = -2

Query: 379 WMESLFISCPLRQMILLRGASNIQMSRTNNASNRPLLSSVNFILGQQLE 233
           W++SL  S P    +L RG+S     +  NAS   ++  ++ ++ + LE
Sbjct: 613 WLDSLSSSLP--SSLLNRGSSTHSWEKLTNASTEEVMLPLDMVVNELLE 659


>SPBC106.08c |mug2||DUF1773 family protein 1|Schizosaccharomyces
           pombe|chr 2|||Manual
          Length = 296

 Score = 27.5 bits (58), Expect = 1.5
 Identities = 16/52 (30%), Positives = 25/52 (48%)
 Frame = -1

Query: 404 RETCIGTALDGVSLHQLPIETDDTIKRSVKHTDESHEQCIEQTTFEQREFHL 249
           RE C+ T + G   + +PI++ DT+    K  D    +     +FE   FHL
Sbjct: 245 REQCL-TFIQG---YGIPIDSSDTVYLKEKLRDAIGMRAFTDMSFEMNSFHL 292


>SPACUNK4.08 |||dipeptidyl aminopeptidase |Schizosaccharomyces
           pombe|chr 1|||Manual
          Length = 793

 Score = 27.5 bits (58), Expect = 1.5
 Identities = 11/42 (26%), Positives = 22/42 (52%), Gaps = 1/42 (2%)
 Frame = +2

Query: 62  DRVASMRARARDCPTYSQPTLACPLNPA-PELQSEKEFSQRF 184
           D++A ++    + PTY  P     L+P+ PE    K+ + ++
Sbjct: 238 DKIAFLKLNESEIPTYHYPLYTAELDPSLPEFDYNKDMAIKY 279


>SPBC16C6.02c |vps1302|vps13b|chorein homolog|Schizosaccharomyces
           pombe|chr 2|||Manual
          Length = 3131

 Score = 26.6 bits (56), Expect = 2.7
 Identities = 13/43 (30%), Positives = 20/43 (46%)
 Frame = -2

Query: 280 RPLLSSVNFILGQQLEARDEAGKVNHATYYMGETLRKFLFRLQ 152
           R  L S   +LG   E ++E+ K+N   Y M E   +   + Q
Sbjct: 691 RVSLESARLLLGPLNELKNESNKINEEYYLMNELNTEIFIQAQ 733


>SPAC23G3.05c |||regulator of G-protein signaling
           |Schizosaccharomyces pombe|chr 1|||Manual
          Length = 343

 Score = 25.8 bits (54), Expect = 4.7
 Identities = 18/55 (32%), Positives = 24/55 (43%)
 Frame = -2

Query: 322 ASNIQMSRTNNASNRPLLSSVNFILGQQLEARDEAGKVNHATYYMGETLRKFLFR 158
           AS  ++S      N P LS  NF +      RDE   +     ++   L KFLFR
Sbjct: 2   ASAPRVSEVLTKKNLPPLSLYNFYI----YIRDEENAIEFLDLFLDIMLHKFLFR 52


>SPBC146.11c |mug97|meu33|meiotically upregulated gene
           Mug97|Schizosaccharomyces pombe|chr 2|||Manual
          Length = 335

 Score = 25.4 bits (53), Expect = 6.2
 Identities = 12/37 (32%), Positives = 19/37 (51%)
 Frame = -1

Query: 506 GRSGVMRTIARKALFPRPSNSWNSYVPQT*K*NQRET 396
           G SG+ + ++     P+  NSW   VP T + +  ET
Sbjct: 88  GASGIHKQMSLPEYSPQMGNSWEIQVPMTTRHSISET 124


>SPBC16A3.03c |lyn1||sequence orphan|Schizosaccharomyces pombe|chr
           2|||Manual
          Length = 658

 Score = 25.0 bits (52), Expect = 8.2
 Identities = 11/23 (47%), Positives = 14/23 (60%)
 Frame = +2

Query: 398 FLVDSTFKFAERMNSMNLTDAEI 466
           FLV+   +F ER  S NLT+  I
Sbjct: 176 FLVELCLRFLERFRSCNLTEQAI 198


  Database: spombe
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 2,362,478
  Number of sequences in database:  5004
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 2,307,956
Number of Sequences: 5004
Number of extensions: 44498
Number of successful extensions: 130
Number of sequences better than 10.0: 9
Number of HSP's better than 10.0 without gapping: 126
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 130
length of database: 2,362,478
effective HSP length: 69
effective length of database: 2,017,202
effective search space used: 254167452
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -