SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS20017
         (763 letters)

Database: spombe 
           5004 sequences; 2,362,478 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SPAC2F7.10 |||palmitoyltransferase |Schizosaccharomyces pombe|ch...    27   3.9  
SPAC4H3.05 |srs2||ATP-dependent DNA helicase, UvrD subfamily|Sch...    27   3.9  
SPAC19B12.07c |||human ZNF277P homolog|Schizosaccharomyces pombe...    27   3.9  
SPBC337.04 |ppk27||serine/threonine protein kinase Ppk27 |Schizo...    25   8.9  
SPCC338.16 |pof3||F-box protein Pof3|Schizosaccharomyces pombe|c...    25   8.9  

>SPAC2F7.10 |||palmitoyltransferase |Schizosaccharomyces pombe|chr
           1|||Manual
          Length = 642

 Score = 26.6 bits (56), Expect = 3.9
 Identities = 11/26 (42%), Positives = 12/26 (46%)
 Frame = -2

Query: 720 FNLYGVKTAPWRQRREAKNSH*AHGS 643
           F  YG    P +Q    KN H  HGS
Sbjct: 535 FKRYGTLVPPTKQNSSPKNGHGIHGS 560


>SPAC4H3.05 |srs2||ATP-dependent DNA helicase, UvrD
           subfamily|Schizosaccharomyces pombe|chr 1|||Manual
          Length = 887

 Score = 26.6 bits (56), Expect = 3.9
 Identities = 12/41 (29%), Positives = 23/41 (56%)
 Frame = -3

Query: 206 FQKSLCHFCIIFEKLSTKRVNNGVAYCMYNFLIGIIRYLRF 84
           F KSL  F     KL  + ++NG +  + + L+GI+  +++
Sbjct: 479 FLKSLKSFLCSISKLENRYLSNGHSATLSDLLLGILSEIKY 519


>SPAC19B12.07c |||human ZNF277P homolog|Schizosaccharomyces
           pombe|chr 1|||Manual
          Length = 319

 Score = 26.6 bits (56), Expect = 3.9
 Identities = 12/34 (35%), Positives = 18/34 (52%)
 Frame = -3

Query: 392 IVRLSMRIKYGASEYRLLCCLIICIKYRPVRTHL 291
           I RL  +IK     +R LCC + C   + +R H+
Sbjct: 132 INRLLEKIKNELESFRCLCCHVPCKNKKLLREHM 165


>SPBC337.04 |ppk27||serine/threonine protein kinase Ppk27
           |Schizosaccharomyces pombe|chr 2|||Manual
          Length = 413

 Score = 25.4 bits (53), Expect = 8.9
 Identities = 13/43 (30%), Positives = 25/43 (58%)
 Frame = -3

Query: 233 VKVFNKELFFQKSLCHFCIIFEKLSTKRVNNGVAYCMYNFLIG 105
           VKVF +E++  K+L H C++  +L    V++     + N+ +G
Sbjct: 149 VKVFRQEIWALKTLSHPCVV--QLLNYYVSSAELILVENYCMG 189


>SPCC338.16 |pof3||F-box protein Pof3|Schizosaccharomyces pombe|chr
           3|||Manual
          Length = 577

 Score = 25.4 bits (53), Expect = 8.9
 Identities = 10/17 (58%), Positives = 14/17 (82%)
 Frame = -3

Query: 746 TYSMASKLTSICMELKQ 696
           T+S+ASK+ S C +LKQ
Sbjct: 273 TFSIASKILSCCKKLKQ 289


  Database: spombe
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 2,362,478
  Number of sequences in database:  5004
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 2,859,596
Number of Sequences: 5004
Number of extensions: 54581
Number of successful extensions: 133
Number of sequences better than 10.0: 5
Number of HSP's better than 10.0 without gapping: 129
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 133
length of database: 2,362,478
effective HSP length: 71
effective length of database: 2,007,194
effective search space used: 365309308
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -