SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS20015
         (627 letters)

Database: spombe 
           5004 sequences; 2,362,478 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SPBC1347.07 |rex2||RNA exonuclease|Schizosaccharomyces pombe|chr...    48   8e-07
SPAC23C11.15 |pst2||Clr6 histone deacetylase complex subunit Pst...    27   1.7  
SPAC22E12.11c |set3||histone lysine methyltransferase Set3|Schiz...    26   5.1  
SPAC2E1P5.05 |||U3 snoRNP-associated protein Rrp9 |Schizosacchar...    25   6.8  
SPAPB1A10.07c |||sphingolipid biosynthesis protein|Schizosacchar...    25   9.0  

>SPBC1347.07 |rex2||RNA exonuclease|Schizosaccharomyces pombe|chr
           2|||Manual
          Length = 180

 Score = 48.4 bits (110), Expect = 8e-07
 Identities = 22/56 (39%), Positives = 35/56 (62%)
 Frame = +3

Query: 342 DIAQRIVWMDLEMTGLDIENDHIMEIACLVTDAQLNVVATGPDIVINLPEVTLNKI 509
           ++ Q +VW+D EMTGL++    +ME+A ++TD  L  V    D VI L E  L+++
Sbjct: 3   NLKQPLVWIDCEMTGLEVGKHVLMEVAAIITDGNLRPVEEKFDAVIKLDEKQLSEM 58



 Score = 42.3 bits (95), Expect = 6e-05
 Identities = 14/39 (35%), Positives = 27/39 (69%)
 Frame = +2

Query: 509 NNWCKVQHGETGLTEACLKSDTSLAEAERIILKFVSNHV 625
           N+WC  QHG++GLTE C +S+ ++ + E  +L ++  ++
Sbjct: 59  NDWCIEQHGKSGLTERCRQSNLTVKDVENQLLAYIKKYI 97


>SPAC23C11.15 |pst2||Clr6 histone deacetylase complex subunit
           Pst2|Schizosaccharomyces pombe|chr 1|||Manual
          Length = 1075

 Score = 27.5 bits (58), Expect = 1.7
 Identities = 13/33 (39%), Positives = 18/33 (54%)
 Frame = +3

Query: 444 LNVVATGPDIVINLPEVTLNKIITGVRSNTARQ 542
           L+ V  GPD  +N P +  NK +   RSN+  Q
Sbjct: 614 LDQVFRGPDYDVNAPNIVGNKPVRRKRSNSITQ 646


>SPAC22E12.11c |set3||histone lysine methyltransferase
           Set3|Schizosaccharomyces pombe|chr 1|||Manual
          Length = 859

 Score = 25.8 bits (54), Expect = 5.1
 Identities = 12/31 (38%), Positives = 18/31 (58%)
 Frame = +3

Query: 126 SEIVCM*CNVVQLLISFFLCNDMQLRSTCKV 218
           SE++   C VV +  S F C+   L STC++
Sbjct: 205 SEVLMDGCQVVPISSSKFCCSRFGLVSTCEI 235


>SPAC2E1P5.05 |||U3 snoRNP-associated protein Rrp9
           |Schizosaccharomyces pombe|chr 1|||Manual
          Length = 524

 Score = 25.4 bits (53), Expect = 6.8
 Identities = 10/23 (43%), Positives = 12/23 (52%)
 Frame = +3

Query: 396 ENDHIMEIACLVTDAQLNVVATG 464
           ENDH+ EI CL        + TG
Sbjct: 204 ENDHVKEITCLAISNDGRWIVTG 226


>SPAPB1A10.07c |||sphingolipid biosynthesis
           protein|Schizosaccharomyces pombe|chr 1|||Manual
          Length = 441

 Score = 25.0 bits (52), Expect = 9.0
 Identities = 10/30 (33%), Positives = 18/30 (60%)
 Frame = +1

Query: 136 YVCNVMLYNY*FHFFCVMTCSYVQHVKSIS 225
           YV  ++L    + FFC  +CS+ Q + +I+
Sbjct: 210 YVVGLVLTILTYVFFCASSCSFNQAINTIN 239


  Database: spombe
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 2,362,478
  Number of sequences in database:  5004
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 2,367,772
Number of Sequences: 5004
Number of extensions: 48617
Number of successful extensions: 123
Number of sequences better than 10.0: 5
Number of HSP's better than 10.0 without gapping: 120
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 123
length of database: 2,362,478
effective HSP length: 70
effective length of database: 2,012,198
effective search space used: 277683324
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -