SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS20013
         (724 letters)

Database: spombe 
           5004 sequences; 2,362,478 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SPCC584.04 |sup35|erf3|translation release factor eRF3 |Schizosa...   143   3e-35
SPCC794.09c |ef1a-a||translation elongation factor EF-1 alpha Ef...    89   4e-19
SPAC23A1.10 |ef1a-b||translation elongation factor EF-1 alpha Ef...    89   6e-19
SPBC25B2.01 ||SPBC2G5.08|elongation factor 1 alpha related prote...    89   6e-19
SPBC839.15c |ef1a-c||translation elongation factor EF-1 alpha Ef...    89   6e-19
SPBC9B6.04c |tuf1||mitochondrial translation elongation factor E...    58   1e-09
SPBC1271.15c |||translation initiation factor IF-2Mt|Schizosacch...    35   0.014
SPBC17G9.09 |tif213||translation initiation factor eIF2 gamma su...    34   0.024
SPBC660.10 |||translation elongation factor G|Schizosaccharomyce...    33   0.055
SPAC23H3.13c |gpa2|git8|heterotrimeric G protein alpha-2 subunit...    32   0.072
SPAC1B3.04c |||mitochondrial GTPase Guf1 |Schizosaccharomyces po...    31   0.13 
SPBC557.05 |||arrestin|Schizosaccharomyces pombe|chr 2|||Manual        30   0.38 
SPAC56F8.03 |||translation initiation factor IF2 |Schizosaccharo...    30   0.38 
SPCC553.08c |||GTPase Ria1 |Schizosaccharomyces pombe|chr 3|||Ma...    30   0.38 
SPCP31B10.07 |eft202||translation elongation factor 2 |Schizosac...    29   0.89 
SPCC736.07c |||cell polarity protein |Schizosaccharomyces pombe|...    29   0.89 
SPAC513.01c |eft201|eft2-1, etf2, SPAPYUK71.04c|translation elon...    29   0.89 
SPAC11D3.08c |||amino acid permease, unknown 1|Schizosaccharomyc...    29   0.89 
SPBC215.12 |cwf10|spef2, snu114|GTPase Cwf10 |Schizosaccharomyce...    28   1.2  
SPBC1306.01c ||SPBC409.22c|translation elongation factor G|Schiz...    27   3.6  
SPBC30D10.05c |||sepiapterin reductase |Schizosaccharomyces pomb...    27   3.6  
SPBC9B6.10 |cdc37||Hsp90 co-chaperone Cdc37|Schizosaccharomyces ...    26   4.7  
SPCC1840.12 ||SPCC965.02|OPT oligopeptide transporter family|Sch...    25   8.3  

>SPCC584.04 |sup35|erf3|translation release factor eRF3
           |Schizosaccharomyces pombe|chr 3|||Manual
          Length = 662

 Score =  143 bits (346), Expect = 3e-35
 Identities = 62/82 (75%), Positives = 73/82 (89%)
 Frame = +3

Query: 264 WYLSWALDTNQEERDKGKTVEVGRAYFETEKKHFTILDAPGHKSFVPNMIGGAAQADLAV 443
           WYLSWALD+  EER+KGKTVEVGRAYFETE + F++LDAPGHK +V NMI GA+QAD+ V
Sbjct: 285 WYLSWALDSTSEEREKGKTVEVGRAYFETEHRRFSLLDAPGHKGYVTNMINGASQADIGV 344

Query: 444 LVISARKGEFETGFDRGGQTRD 509
           LVISAR+GEFE GF+RGGQTR+
Sbjct: 345 LVISARRGEFEAGFERGGQTRE 366



 Score = 83.0 bits (196), Expect = 4e-17
 Identities = 39/67 (58%), Positives = 50/67 (74%)
 Frame = +1

Query: 118 KEHVNVVFIGHVDAGKSTIGGQIMSLTGMVDKRTLEKYEREAREKSENHGTYHGHWTQIK 297
           KEHVN+VFIGHVDAGKST+GG I+ LTGMVDKRT+EK EREA+E  +   +++  W    
Sbjct: 236 KEHVNIVFIGHVDAGKSTLGGNILFLTGMVDKRTMEKIEREAKEAGKE--SWYLSWALDS 293

Query: 298 KNETKAK 318
            +E + K
Sbjct: 294 TSEEREK 300



 Score = 64.9 bits (151), Expect = 1e-11
 Identities = 25/53 (47%), Positives = 37/53 (69%)
 Frame = +2

Query: 509 HAMLAKTAGVKHLVALVNKMDDPTVNWDEKRYNECREKILPYLKNWVSIQRKT 667
           HA+LA+T G+ HLV ++NKMD+P+V W E+RY EC +K+  +L+       KT
Sbjct: 367 HAVLARTQGINHLVVVINKMDEPSVQWSEERYKECVDKLSMFLRRVAGYNSKT 419



 Score = 27.5 bits (58), Expect = 2.1
 Identities = 9/22 (40%), Positives = 16/22 (72%)
 Frame = +1

Query: 646 GFNTAKDLSFLPVSGQTGQVIR 711
           G+N+  D+ ++PVS  TGQ ++
Sbjct: 414 GYNSKTDVKYMPVSAYTGQNVK 435


>SPCC794.09c |ef1a-a||translation elongation factor EF-1 alpha
           Ef1a-a |Schizosaccharomyces pombe|chr 3|||Manual
          Length = 460

 Score = 89.4 bits (212), Expect = 4e-19
 Identities = 38/79 (48%), Positives = 54/79 (68%)
 Frame = +3

Query: 273 SWALDTNQEERDKGKTVEVGRAYFETEKKHFTILDAPGHKSFVPNMIGGAAQADLAVLVI 452
           +W LD  + ER++G T+++    FET K + T++DAPGH+ F+ NMI G +QAD AVL+I
Sbjct: 57  AWVLDKLKAERERGITIDIALWKFETPKYNVTVIDAPGHRDFIKNMITGTSQADCAVLII 116

Query: 453 SARKGEFETGFDRGGQTRD 509
               GEFE G  + GQTR+
Sbjct: 117 GGGTGEFEAGISKDGQTRE 135



 Score = 60.9 bits (141), Expect = 2e-10
 Identities = 27/53 (50%), Positives = 37/53 (69%)
 Frame = +1

Query: 115 KKEHVNVVFIGHVDAGKSTIGGQIMSLTGMVDKRTLEKYEREAREKSENHGTY 273
           +K H+NVV IGHVD+GKST  G ++   G +DKRT+EK+E+EA E  +    Y
Sbjct: 4   EKGHINVVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEATELGKGSFKY 56



 Score = 43.6 bits (98), Expect = 3e-05
 Identities = 23/55 (41%), Positives = 31/55 (56%)
 Frame = +2

Query: 509 HAMLAKTAGVKHLVALVNKMDDPTVNWDEKRYNECREKILPYLKNWVSIQRKTYP 673
           HA+LA T GVK L+  VNKMD  T  W + R+ E  ++   ++K  V    KT P
Sbjct: 136 HALLAYTLGVKQLIVAVNKMD--TTGWSQARFEEIVKETSNFIKK-VGFNPKTVP 187


>SPAC23A1.10 |ef1a-b||translation elongation factor EF-1 alpha
           Ef1a-b |Schizosaccharomyces pombe|chr 1|||Manual
          Length = 460

 Score = 89.0 bits (211), Expect = 6e-19
 Identities = 37/79 (46%), Positives = 54/79 (68%)
 Frame = +3

Query: 273 SWALDTNQEERDKGKTVEVGRAYFETEKKHFTILDAPGHKSFVPNMIGGAAQADLAVLVI 452
           +W LD  + ER++G T+++    FET K + T++DAPGH+ F+ NMI G +QAD A+L+I
Sbjct: 57  AWVLDKLKAERERGITIDIALWKFETPKYNVTVIDAPGHRDFIKNMITGTSQADCAILII 116

Query: 453 SARKGEFETGFDRGGQTRD 509
               GEFE G  + GQTR+
Sbjct: 117 GGGTGEFEAGISKDGQTRE 135



 Score = 60.9 bits (141), Expect = 2e-10
 Identities = 27/53 (50%), Positives = 37/53 (69%)
 Frame = +1

Query: 115 KKEHVNVVFIGHVDAGKSTIGGQIMSLTGMVDKRTLEKYEREAREKSENHGTY 273
           +K H+NVV IGHVD+GKST  G ++   G +DKRT+EK+E+EA E  +    Y
Sbjct: 4   EKGHINVVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEATELGKGSFKY 56



 Score = 43.6 bits (98), Expect = 3e-05
 Identities = 23/55 (41%), Positives = 31/55 (56%)
 Frame = +2

Query: 509 HAMLAKTAGVKHLVALVNKMDDPTVNWDEKRYNECREKILPYLKNWVSIQRKTYP 673
           HA+LA T GVK L+  VNKMD  T  W + R+ E  ++   ++K  V    KT P
Sbjct: 136 HALLAYTLGVKQLIVAVNKMD--TTGWSQARFEEIVKETSNFIKK-VGFNPKTVP 187


>SPBC25B2.01 ||SPBC2G5.08|elongation factor 1 alpha related
           protein|Schizosaccharomyces pombe|chr 2|||Manual
          Length = 592

 Score = 89.0 bits (211), Expect = 6e-19
 Identities = 39/79 (49%), Positives = 54/79 (68%)
 Frame = +3

Query: 273 SWALDTNQEERDKGKTVEVGRAYFETEKKHFTILDAPGHKSFVPNMIGGAAQADLAVLVI 452
           +W LDT +EER +G T++V    FE++KK + I DAPGH+ F+  MI GA+ AD AVLV+
Sbjct: 227 AWLLDTTEEERARGVTMDVASTTFESDKKIYEIGDAPGHRDFISGMIAGASSADFAVLVV 286

Query: 453 SARKGEFETGFDRGGQTRD 509
            + +  FE GF   GQTR+
Sbjct: 287 DSSQNNFERGFLENGQTRE 305



 Score = 50.8 bits (116), Expect = 2e-07
 Identities = 30/106 (28%), Positives = 57/106 (53%), Gaps = 6/106 (5%)
 Frame = +1

Query: 19  DTQVGNTNPNEDGELTKKIPKKKP------PRVEDTRSKKEHVNVVFIGHVDAGKSTIGG 180
           + ++ N++ +++    KKI K+ P      P + +  + K  V++V  GHVD+GKST+ G
Sbjct: 136 EVKMKNSSESDNQPEKKKIKKQNPTDLVSVPEIFEQSNPKPVVHLVVTGHVDSGKSTMLG 195

Query: 181 QIMSLTGMVDKRTLEKYEREAREKSENHGTYHGHWTQIKKNETKAK 318
           +IM   G ++ R+++K   EA    +  G++   W      E +A+
Sbjct: 196 RIMFELGEINSRSMQKLHNEAANSGK--GSFSYAWLLDTTEEERAR 239


>SPBC839.15c |ef1a-c||translation elongation factor EF-1 alpha
           Ef1a-c |Schizosaccharomyces pombe|chr 2|||Manual
          Length = 460

 Score = 89.0 bits (211), Expect = 6e-19
 Identities = 37/79 (46%), Positives = 54/79 (68%)
 Frame = +3

Query: 273 SWALDTNQEERDKGKTVEVGRAYFETEKKHFTILDAPGHKSFVPNMIGGAAQADLAVLVI 452
           +W LD  + ER++G T+++    FET K + T++DAPGH+ F+ NMI G +QAD A+L+I
Sbjct: 57  AWVLDKLKAERERGITIDIALWKFETPKYNVTVIDAPGHRDFIKNMITGTSQADCAILII 116

Query: 453 SARKGEFETGFDRGGQTRD 509
               GEFE G  + GQTR+
Sbjct: 117 GGGTGEFEAGISKDGQTRE 135



 Score = 60.9 bits (141), Expect = 2e-10
 Identities = 27/53 (50%), Positives = 37/53 (69%)
 Frame = +1

Query: 115 KKEHVNVVFIGHVDAGKSTIGGQIMSLTGMVDKRTLEKYEREAREKSENHGTY 273
           +K H+NVV IGHVD+GKST  G ++   G +DKRT+EK+E+EA E  +    Y
Sbjct: 4   EKGHINVVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEATELGKGSFKY 56



 Score = 43.6 bits (98), Expect = 3e-05
 Identities = 23/55 (41%), Positives = 31/55 (56%)
 Frame = +2

Query: 509 HAMLAKTAGVKHLVALVNKMDDPTVNWDEKRYNECREKILPYLKNWVSIQRKTYP 673
           HA+LA T GVK L+  VNKMD  T  W + R+ E  ++   ++K  V    KT P
Sbjct: 136 HALLAYTLGVKQLIVAVNKMD--TTGWSQARFEEIVKETSNFIKK-VGFNPKTVP 187


>SPBC9B6.04c |tuf1||mitochondrial translation elongation factor
           EF-Tu Tuf1 |Schizosaccharomyces pombe|chr 2|||Manual
          Length = 439

 Score = 58.0 bits (134), Expect = 1e-09
 Identities = 24/63 (38%), Positives = 38/63 (60%)
 Frame = +3

Query: 282 LDTNQEERDKGKTVEVGRAYFETEKKHFTILDAPGHKSFVPNMIGGAAQADLAVLVISAR 461
           +D   EE+ +G T+      +ET  +H+  +D PGH  ++ NMI GAA  D A++V+SA 
Sbjct: 91  IDKAPEEKARGITISSAHVEYETANRHYAHVDCPGHADYIKNMITGAATMDGAIIVVSAT 150

Query: 462 KGE 470
            G+
Sbjct: 151 DGQ 153



 Score = 32.7 bits (71), Expect = 0.055
 Identities = 14/24 (58%), Positives = 17/24 (70%)
 Frame = +1

Query: 115 KKEHVNVVFIGHVDAGKSTIGGQI 186
           KK HVN+  IGHVD GK+T+   I
Sbjct: 50  KKPHVNIGTIGHVDHGKTTLTAAI 73



 Score = 29.1 bits (62), Expect = 0.67
 Identities = 15/42 (35%), Positives = 22/42 (52%)
 Frame = +2

Query: 509 HAMLAKTAGVKHLVALVNKMDDPTVNWDEKRYNECREKILPY 634
           H +LA+  GVK +V  +NK+D    +  E    E RE +  Y
Sbjct: 160 HLLLARQVGVKQIVVYINKVDMVEPDMIELVEMEMRELLSEY 201


>SPBC1271.15c |||translation initiation factor
           IF-2Mt|Schizosaccharomyces pombe|chr 2|||Manual
          Length = 686

 Score = 34.7 bits (76), Expect = 0.014
 Identities = 17/42 (40%), Positives = 22/42 (52%)
 Frame = +3

Query: 342 FETEKKHFTILDAPGHKSFVPNMIGGAAQADLAVLVISARKG 467
           F+   K  T LD PGH +F      GA  AD+ VLV++   G
Sbjct: 215 FDKGSKFITFLDTPGHMAFEAMRKRGANIADIVVLVVAGDDG 256


>SPBC17G9.09 |tif213||translation initiation factor eIF2 gamma
           subunit|Schizosaccharomyces pombe|chr 2|||Manual
          Length = 446

 Score = 33.9 bits (74), Expect = 0.024
 Identities = 13/36 (36%), Positives = 22/36 (61%)
 Frame = +3

Query: 357 KHFTILDAPGHKSFVPNMIGGAAQADLAVLVISARK 464
           +H + +D PGH   +  M+ GAA  D A+L+I+  +
Sbjct: 108 RHVSFVDCPGHDILMATMLNGAAVMDAALLLIAGNE 143



 Score = 26.6 bits (56), Expect = 3.6
 Identities = 14/39 (35%), Positives = 22/39 (56%)
 Frame = +1

Query: 112 SKKEHVNVVFIGHVDAGKSTIGGQIMSLTGMVDKRTLEK 228
           S++  +N+  IGHV  GKST+   I  +  +  K  LE+
Sbjct: 19  SRQATINIGTIGHVAHGKSTVVKAISGVHTVRFKNELER 57


>SPBC660.10 |||translation elongation factor G|Schizosaccharomyces
           pombe|chr 2|||Manual
          Length = 813

 Score = 32.7 bits (71), Expect = 0.055
 Identities = 17/62 (27%), Positives = 25/62 (40%)
 Frame = +3

Query: 282 LDTNQEERDKGKTVEVGRAYFETEKKHFTILDAPGHKSFVPNMIGGAAQADLAVLVISAR 461
           +D    ER +G T+      F    +   ++D PGH  F   +    A  D AV +I   
Sbjct: 68  MDYLPAERQRGITINSAAISFTWRNQRINLIDTPGHADFTFEVERSVAVLDGAVAIIDGS 127

Query: 462 KG 467
            G
Sbjct: 128 AG 129


>SPAC23H3.13c |gpa2|git8|heterotrimeric G protein alpha-2 subunit
           Gpa2 |Schizosaccharomyces pombe|chr 1|||Manual
          Length = 354

 Score = 32.3 bits (70), Expect = 0.072
 Identities = 19/51 (37%), Positives = 30/51 (58%), Gaps = 1/51 (1%)
 Frame = +1

Query: 46  NEDGELTKKIPKKKPPRVEDTRSKKEHV-NVVFIGHVDAGKSTIGGQIMSL 195
           +E GE +KK+  K   ++E+   K + +  V+ +G  D+GKSTI  QI  L
Sbjct: 8   SESGE-SKKLNSKIEKQIENASKKDKKIYKVLLLGASDSGKSTISKQIKIL 57


>SPAC1B3.04c |||mitochondrial GTPase Guf1 |Schizosaccharomyces
           pombe|chr 1|||Manual
          Length = 646

 Score = 31.5 bits (68), Expect = 0.13
 Identities = 17/44 (38%), Positives = 25/44 (56%), Gaps = 5/44 (11%)
 Frame = +1

Query: 130 NVVFIGHVDAGKSTIGGQIMSLTGMVDKRT-----LEKYEREAR 246
           N   I H+D GKST+   I+ LTG++++       L+K E E R
Sbjct: 60  NWAVIAHIDHGKSTLSDCILKLTGVINEHNFRNQFLDKLEVERR 103



 Score = 30.7 bits (66), Expect = 0.22
 Identities = 17/66 (25%), Positives = 31/66 (46%), Gaps = 4/66 (6%)
 Frame = +3

Query: 282 LDTNQEERDKGKTVEVGRA----YFETEKKHFTILDAPGHKSFVPNMIGGAAQADLAVLV 449
           LD  + ER +G TV+        Y+  +     ++D PGH  F   ++   A  +  +L+
Sbjct: 95  LDKLEVERRRGITVKAQTCSMIYYYHGQSYLLNLIDTPGHVDFRAEVMHSLAACEGCILL 154

Query: 450 ISARKG 467
           + A +G
Sbjct: 155 VDASQG 160


>SPBC557.05 |||arrestin|Schizosaccharomyces pombe|chr 2|||Manual
          Length = 433

 Score = 29.9 bits (64), Expect = 0.38
 Identities = 14/37 (37%), Positives = 20/37 (54%)
 Frame = +3

Query: 96  SRRYTKQKRTCKCSIYRTCRCRKVDYWWSNNVTHWNG 206
           SR+ ++  +TCKC    T RC K      +N  +WNG
Sbjct: 289 SRKNSEVSKTCKCLQKETIRCNK-----KSNCYNWNG 320


>SPAC56F8.03 |||translation initiation factor IF2
           |Schizosaccharomyces pombe|chr 1|||Manual
          Length = 1079

 Score = 29.9 bits (64), Expect = 0.38
 Identities = 13/33 (39%), Positives = 19/33 (57%)
 Frame = +3

Query: 369 ILDAPGHKSFVPNMIGGAAQADLAVLVISARKG 467
           I+D PGH+SF      G +  ++A+LVI    G
Sbjct: 553 IIDTPGHESFTNLRSRGTSLCNIAILVIDIMHG 585


>SPCC553.08c |||GTPase Ria1 |Schizosaccharomyces pombe|chr
           3|||Manual
          Length = 1000

 Score = 29.9 bits (64), Expect = 0.38
 Identities = 11/49 (22%), Positives = 27/49 (55%), Gaps = 1/49 (2%)
 Frame = +1

Query: 73  IPKKKPPRVEDTRSKKEHV-NVVFIGHVDAGKSTIGGQIMSLTGMVDKR 216
           +P   P ++   +  +E++ N   + HVD GK+T+   +++  G++  +
Sbjct: 1   MPVIPPEKLVSLQKNQENIRNFTLLAHVDHGKTTLADSLLASNGIISSK 49


>SPCP31B10.07 |eft202||translation elongation factor 2
           |Schizosaccharomyces pombe|chr 3|||Manual
          Length = 842

 Score = 28.7 bits (61), Expect = 0.89
 Identities = 14/41 (34%), Positives = 22/41 (53%), Gaps = 1/41 (2%)
 Frame = +1

Query: 88  PPRVEDTRSKKEHV-NVVFIGHVDAGKSTIGGQIMSLTGMV 207
           P  V +   K  +V N+  I HVD GKST+   ++   G++
Sbjct: 6   PEEVRNLMGKPSNVRNMSVIAHVDHGKSTLTDSLVQKAGII 46


>SPCC736.07c |||cell polarity protein |Schizosaccharomyces pombe|chr
           3|||Manual
          Length = 699

 Score = 28.7 bits (61), Expect = 0.89
 Identities = 13/41 (31%), Positives = 24/41 (58%), Gaps = 2/41 (4%)
 Frame = +1

Query: 16  LDTQVGNT--NPNEDGELTKKIPKKKPPRVEDTRSKKEHVN 132
           L+ +  NT  NP E+ + T +   K PP+ + + + KE++N
Sbjct: 564 LNNRAANTKLNPKEEDKSTVESELKAPPKEKSSETSKEYLN 604


>SPAC513.01c |eft201|eft2-1, etf2, SPAPYUK71.04c|translation
           elongation factor 2 |Schizosaccharomyces pombe|chr
           1|||Manual
          Length = 842

 Score = 28.7 bits (61), Expect = 0.89
 Identities = 14/41 (34%), Positives = 22/41 (53%), Gaps = 1/41 (2%)
 Frame = +1

Query: 88  PPRVEDTRSKKEHV-NVVFIGHVDAGKSTIGGQIMSLTGMV 207
           P  V +   K  +V N+  I HVD GKST+   ++   G++
Sbjct: 6   PEEVRNLMGKPSNVRNMSVIAHVDHGKSTLTDSLVQKAGII 46


>SPAC11D3.08c |||amino acid permease, unknown 1|Schizosaccharomyces
           pombe|chr 1|||Manual
          Length = 550

 Score = 28.7 bits (61), Expect = 0.89
 Identities = 15/42 (35%), Positives = 20/42 (47%)
 Frame = -3

Query: 149 CPINTTFTCSFLLRVSSTRGGFFFGIFFVNSPSSLGFVFPTC 24
           C I  + +   L     T GG +F IF + SPSS  F+   C
Sbjct: 92  CLIPVSISLGELASSMPTSGGLYFWIFTLASPSSRAFLCWVC 133


>SPBC215.12 |cwf10|spef2, snu114|GTPase Cwf10 |Schizosaccharomyces
           pombe|chr 2|||Manual
          Length = 983

 Score = 28.3 bits (60), Expect = 1.2
 Identities = 13/35 (37%), Positives = 18/35 (51%)
 Frame = +3

Query: 363 FTILDAPGHKSFVPNMIGGAAQADLAVLVISARKG 467
           F  +D PGH  FV  +    A +D  VLV+   +G
Sbjct: 211 FQCIDTPGHVDFVDEVAAPMAISDGVVLVVDVIEG 245


>SPBC1306.01c ||SPBC409.22c|translation elongation factor
           G|Schizosaccharomyces pombe|chr 2|||Manual
          Length = 770

 Score = 26.6 bits (56), Expect = 3.6
 Identities = 10/35 (28%), Positives = 20/35 (57%)
 Frame = +1

Query: 103 DTRSKKEHVNVVFIGHVDAGKSTIGGQIMSLTGMV 207
           D +  K+  N+    H+D+GK+T   +++  TG +
Sbjct: 52  DKKRLKQIRNIGISAHIDSGKTTFTERVLYYTGRI 86



 Score = 26.2 bits (55), Expect = 4.7
 Identities = 17/67 (25%), Positives = 30/67 (44%)
 Frame = +3

Query: 267 YLSWALDTNQEERDKGKTVEVGRAYFETEKKHFTILDAPGHKSFVPNMIGGAAQADLAVL 446
           + +W    +Q E ++ +  +  ++Y      +  I+D PGH  F   +       D AVL
Sbjct: 121 HCTWERTVDQIEANEKQKTDFEKSY------NINIIDTPGHIDFTIEVERALRVLDGAVL 174

Query: 447 VISARKG 467
           V+ A  G
Sbjct: 175 VLCAVSG 181


>SPBC30D10.05c |||sepiapterin reductase |Schizosaccharomyces
           pombe|chr 2|||Manual
          Length = 247

 Score = 26.6 bits (56), Expect = 3.6
 Identities = 17/43 (39%), Positives = 21/43 (48%)
 Frame = +3

Query: 309 KGKTVEVGRAYFETEKKHFTILDAPGHKSFVPNMIGGAAQADL 437
           KG   EVG+A  ET  K F  LD+    + V   I   A AD+
Sbjct: 58  KGDVTEVGKASIETAIKKFGKLDSVILNAGVLEPIAKIADADI 100


>SPBC9B6.10 |cdc37||Hsp90 co-chaperone Cdc37|Schizosaccharomyces
           pombe|chr 2|||Manual
          Length = 466

 Score = 26.2 bits (55), Expect = 4.7
 Identities = 15/60 (25%), Positives = 29/60 (48%), Gaps = 1/60 (1%)
 Frame = +1

Query: 73  IPKKKPPRVEDTRSKKEHVNVV-FIGHVDAGKSTIGGQIMSLTGMVDKRTLEKYEREARE 249
           + KK+P + + T++KKE + V+  + +        G +  + TG   K  + + E E  E
Sbjct: 183 VQKKEPEKPKKTKTKKETIQVIESLNNPTPPTDFPGAKEQASTGNAPKNPVNENESEDEE 242


>SPCC1840.12 ||SPCC965.02|OPT oligopeptide transporter
           family|Schizosaccharomyces pombe|chr 3|||Manual
          Length = 791

 Score = 25.4 bits (53), Expect = 8.3
 Identities = 9/23 (39%), Positives = 16/23 (69%)
 Frame = +3

Query: 342 FETEKKHFTILDAPGHKSFVPNM 410
           F+ +KK F I++  GH+ FV ++
Sbjct: 43  FDEQKKSFEIINYAGHEKFVDDI 65


  Database: spombe
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 2,362,478
  Number of sequences in database:  5004
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 2,878,551
Number of Sequences: 5004
Number of extensions: 56615
Number of successful extensions: 229
Number of sequences better than 10.0: 23
Number of HSP's better than 10.0 without gapping: 204
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 229
length of database: 2,362,478
effective HSP length: 71
effective length of database: 2,007,194
effective search space used: 339215786
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -