SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS20009
         (710 letters)

Database: spombe 
           5004 sequences; 2,362,478 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SPBC28F2.03 |ppi1|cyp2|cyclophilin family peptidyl-prolyl cis-tr...   154   1e-38
SPBP8B7.25 |cyp4||cyclophilin family peptidyl-prolyl cis-trans i...   138   5e-34
SPAC1B3.03c |wis2|cyp5|cyclophilin family peptidyl-prolyl cis-tr...   136   3e-33
SPBC1709.04c |cyp3||cyclophilin family peptidyl-prolyl cis-trans...   121   9e-29
SPAC57A10.03 |cyp1||cyclophilin family peptidyl-prolyl cis-trans...   110   2e-25
SPCC553.04 |cyp9||WD repeat containing cyclophilin family peptid...    96   5e-21
SPAC21E11.05c |cyp8||cyclophilin family peptidyl-prolyl cis-tran...    84   2e-17
SPBC16H5.05c |cyp7|cwf27|cyclophilin family peptidyl-prolyl cis-...    57   2e-09
SPBC17G9.05 |rct1|cyp6|RRM-containing cyclophilin regulating tra...    31   0.12 
SPBP8B7.07c |set6||histone lysine methyltransferase Set6 |Schizo...    27   2.6  
SPBC21B10.09 |||acetyl-CoA transporter |Schizosaccharomyces pomb...    27   3.5  
SPCC285.13c |||nucleoporin Nup60 |Schizosaccharomyces pombe|chr ...    27   3.5  
SPAC110.03 |cdc42||Rho family GTPase Cdc42|Schizosaccharomyces p...    27   3.5  
SPAC17D4.04 ||SPAC458.01|tRNA |Schizosaccharomyces pombe|chr 1||...    26   4.6  
SPAP7G5.06 |||amino acid permease, unknown 4|Schizosaccharomyces...    26   6.1  
SPCC16A11.08 |atg20||sorting nexin Atg20|Schizosaccharomyces pom...    25   8.1  
SPBC12C2.10c |pst1|SPBC21D10.01c|Clr6 histone deacetylase comple...    25   8.1  

>SPBC28F2.03 |ppi1|cyp2|cyclophilin family peptidyl-prolyl cis-trans
           isomerase Cyp2|Schizosaccharomyces pombe|chr 2|||Manual
          Length = 162

 Score =  154 bits (374), Expect = 1e-38
 Identities = 71/101 (70%), Positives = 79/101 (78%)
 Frame = +1

Query: 226 GLHFPSCHPHFMLQGGDFTNHNGTGGKSIYGNKFEDENFTLKHTGPGVLSMANAGADTNG 405
           G  F    P FMLQGGDFT  NGTGGKSIYG KF DENF LKH  PG+LSMANAG +TNG
Sbjct: 48  GSTFHRVIPQFMLQGGDFTRGNGTGGKSIYGEKFPDENFALKHNKPGLLSMANAGPNTNG 107

Query: 406 SQFFITTVKTSWLDGRHVVFGNVVEGMEVVKQIETLAATLG 528
           SQFFITTV T WLDG+HVVFG V EGM+VVK++E+L +  G
Sbjct: 108 SQFFITTVVTPWLDGKHVVFGEVTEGMDVVKKVESLGSNSG 148



 Score = 82.2 bits (194), Expect = 7e-17
 Identities = 36/52 (69%), Positives = 40/52 (76%)
 Frame = +2

Query: 98  FFDVTVDDAPLGKIVIELRSDVTPKTCENFRALCTGEKGFGYKGSIFHRVIP 253
           FFDV  +  PLG+IV +L  DV PKT  NFRALCTGEKG+GY GS FHRVIP
Sbjct: 5   FFDVIANGQPLGRIVFKLFDDVVPKTAANFRALCTGEKGYGYAGSTFHRVIP 56



 Score = 26.2 bits (55), Expect = 4.6
 Identities = 11/19 (57%), Positives = 13/19 (68%)
 Frame = +3

Query: 513 GSHSGKTSKRIVIKDCGQI 569
           GS+SG T  RIVI  CG +
Sbjct: 144 GSNSGATRARIVIDKCGTV 162


>SPBP8B7.25 |cyp4||cyclophilin family peptidyl-prolyl cis-trans
           isomerase Cyp4|Schizosaccharomyces pombe|chr 2|||Manual
          Length = 201

 Score =  138 bits (335), Expect = 5e-34
 Identities = 62/94 (65%), Positives = 74/94 (78%)
 Frame = +1

Query: 223 QGLHFPSCHPHFMLQGGDFTNHNGTGGKSIYGNKFEDENFTLKHTGPGVLSMANAGADTN 402
           +G  F    P+FM+QGGD T  +GTGGKSIYG++F DENF L H  PG+LSMANAG D+N
Sbjct: 72  EGSIFHRVIPNFMIQGGDITKGDGTGGKSIYGSRFPDENFKLSHQRPGLLSMANAGPDSN 131

Query: 403 GSQFFITTVKTSWLDGRHVVFGNVVEGMEVVKQI 504
           GSQFFITTVKT WLDG HVVFG V+ G ++VK+I
Sbjct: 132 GSQFFITTVKTPWLDGHHVVFGEVLSGYDIVKKI 165



 Score = 76.6 bits (180), Expect = 3e-15
 Identities = 36/62 (58%), Positives = 41/62 (66%)
 Frame = +2

Query: 68  NTGKMSLPRVFFDVTVDDAPLGKIVIELRSDVTPKTCENFRALCTGEKGFGYKGSIFHRV 247
           N G      V+FD+   D  LG++ I L     PKT ENFRAL TGEKGFGY+GSIFHRV
Sbjct: 20  NRGPKVTDTVYFDLQQGDEFLGRVTIGLFGKTVPKTAENFRALATGEKGFGYEGSIFHRV 79

Query: 248 IP 253
           IP
Sbjct: 80  IP 81


>SPAC1B3.03c |wis2|cyp5|cyclophilin family peptidyl-prolyl cis-trans
           isomerase Wis2|Schizosaccharomyces pombe|chr 1|||Manual
          Length = 356

 Score =  136 bits (329), Expect = 3e-33
 Identities = 65/100 (65%), Positives = 74/100 (74%)
 Frame = +1

Query: 214 LRLQGLHFPSCHPHFMLQGGDFTNHNGTGGKSIYGNKFEDENFTLKHTGPGVLSMANAGA 393
           L  +G  F     +FMLQGGDFT  NGTGG+SIYG KFEDENF LKH  P +LSMANAG 
Sbjct: 49  LTYKGSRFHRVIKNFMLQGGDFTRGNGTGGESIYGEKFEDENFELKHDKPFLLSMANAGP 108

Query: 394 DTNGSQFFITTVKTSWLDGRHVVFGNVVEGMEVVKQIETL 513
           +TNGSQFFITTV T  LDG+HVVFG V++G   V+ IE L
Sbjct: 109 NTNGSQFFITTVPTPHLDGKHVVFGKVIQGKSTVRTIENL 148



 Score = 44.8 bits (101), Expect = 1e-05
 Identities = 24/55 (43%), Positives = 32/55 (58%), Gaps = 4/55 (7%)
 Frame = +2

Query: 98  FFDVTVDDAPLGKIVIELRSDVTPKTCENFRALCTGEKGFG----YKGSIFHRVI 250
           +F +++D      I  EL  +V PKT +NF +LC G +  G    YKGS FHRVI
Sbjct: 6   YFKISIDGKIQPTIYFELFDNVVPKTVKNFASLCNGFEKDGRCLTYKGSRFHRVI 60


>SPBC1709.04c |cyp3||cyclophilin family peptidyl-prolyl cis-trans
           isomerase Cyp3 |Schizosaccharomyces pombe|chr 2|||Manual
          Length = 173

 Score =  121 bits (292), Expect = 9e-29
 Identities = 54/86 (62%), Positives = 70/86 (81%), Gaps = 1/86 (1%)
 Frame = +1

Query: 256 FMLQGGDFTNHNGTGGKSIYGNK-FEDENFTLKHTGPGVLSMANAGADTNGSQFFITTVK 432
           FM+QGGDF + +GTG  +I+ ++ F DENFTLKH  PG+LSMANAG D+NG QFFITTV 
Sbjct: 67  FMIQGGDFVSGDGTGSATIFNSRTFPDENFTLKHDRPGLLSMANAGKDSNGCQFFITTVP 126

Query: 433 TSWLDGRHVVFGNVVEGMEVVKQIET 510
             +LDG+HVVFG V+EG ++VK+IE+
Sbjct: 127 CDFLDGKHVVFGEVIEGYDIVKEIES 152



 Score = 62.5 bits (145), Expect = 6e-11
 Identities = 31/60 (51%), Positives = 36/60 (60%), Gaps = 6/60 (10%)
 Frame = +2

Query: 89  PRVFFDVTVDDAPLGKIVIELRSDVTPKTCENFRALCTGE------KGFGYKGSIFHRVI 250
           P VF D+ +D   LG+I I L S + PKT ENFR  CTGE      K  GYK S FHR+I
Sbjct: 5   PVVFMDIAIDGRLLGRIKIRLFSSIVPKTAENFRQFCTGETLGVNQKPIGYKNSTFHRII 64


>SPAC57A10.03 |cyp1||cyclophilin family peptidyl-prolyl cis-trans
           isomerase Cyp1|Schizosaccharomyces pombe|chr 1|||Manual
          Length = 155

 Score =  110 bits (264), Expect = 2e-25
 Identities = 53/94 (56%), Positives = 66/94 (70%), Gaps = 1/94 (1%)
 Frame = +1

Query: 226 GLHFPSCHPHFMLQGGDFTNHNGTGGKSIYGNKFEDE-NFTLKHTGPGVLSMANAGADTN 402
           G+ F    P F++QGGD T   G GG SIYG+KF+DE +  L HTG G+LSMANAG +TN
Sbjct: 40  GVIFHRVIPDFVIQGGDPTG-TGRGGTSIYGDKFDDEIHSDLHHTGAGILSMANAGPNTN 98

Query: 403 GSQFFITTVKTSWLDGRHVVFGNVVEGMEVVKQI 504
            SQFFIT   T WLDG+H +FG VV G+ V K++
Sbjct: 99  SSQFFITLAPTPWLDGKHTIFGRVVSGLSVCKRM 132



 Score = 50.0 bits (114), Expect = 3e-07
 Identities = 29/58 (50%), Positives = 37/58 (63%)
 Frame = +2

Query: 128 LGKIVIELRSDVTPKTCENFRALCTGEKGFGYKGSIFHRVIPISCCKEGTSPTITALG 301
           LGKI+IEL ++  PKTC+NF  L   ++G+ Y G IFHRVIP     +G  PT T  G
Sbjct: 10  LGKILIELYTEHAPKTCQNFYTL--AKEGY-YDGVIFHRVIP-DFVIQGGDPTGTGRG 63


>SPCC553.04 |cyp9||WD repeat containing cyclophilin family
           peptidyl-prolyl cis-trans isomerase
           Cyp9|Schizosaccharomyces pombe|chr 3|||Manual
          Length = 610

 Score = 95.9 bits (228), Expect = 5e-21
 Identities = 47/86 (54%), Positives = 61/86 (70%), Gaps = 1/86 (1%)
 Frame = +1

Query: 253 HFMLQGGDFTNHNGTGGKSIYGNKFEDE-NFTLKHTGPGVLSMANAGADTNGSQFFITTV 429
           +FM+QGGD    +GTGG+SI+   FEDE +  LKH  P  +SMAN+G +TNGSQFFITT 
Sbjct: 502 NFMIQGGDPLG-DGTGGESIWKKDFEDEISPNLKHDRPFTVSMANSGPNTNGSQFFITTD 560

Query: 430 KTSWLDGRHVVFGNVVEGMEVVKQIE 507
            T WLDG+H +F     G++VV +IE
Sbjct: 561 LTPWLDGKHTIFARAYAGLDVVHRIE 586


>SPAC21E11.05c |cyp8||cyclophilin family peptidyl-prolyl cis-trans
           isomerase Cyp8|Schizosaccharomyces pombe|chr 1|||Manual
          Length = 516

 Score = 83.8 bits (198), Expect = 2e-17
 Identities = 42/85 (49%), Positives = 55/85 (64%), Gaps = 1/85 (1%)
 Frame = +1

Query: 256 FMLQGGDFTNHNGTGGKSIYGNKFEDENFT-LKHTGPGVLSMANAGADTNGSQFFITTVK 432
           FM+QGGD  +  G GG+SI+G  F+DE    LKH   G++SMAN G +TNGSQFFI    
Sbjct: 324 FMIQGGD-PSGTGRGGQSIWGKPFKDEFCNPLKHDDRGIISMANRGKNTNGSQFFILYGP 382

Query: 433 TSWLDGRHVVFGNVVEGMEVVKQIE 507
              LD +H +FG VV G+ V+  +E
Sbjct: 383 AKHLDNKHTIFGRVVGGLNVLDALE 407


>SPBC16H5.05c |cyp7|cwf27|cyclophilin family peptidyl-prolyl
           cis-trans isomerase Cyp7|Schizosaccharomyces pombe|chr
           2|||Manual
          Length = 463

 Score = 57.2 bits (132), Expect = 2e-09
 Identities = 33/77 (42%), Positives = 43/77 (55%), Gaps = 1/77 (1%)
 Frame = +1

Query: 250 PHFMLQGGDFTNHNGTGGKSIYGNKFEDENFT-LKHTGPGVLSMANAGADTNGSQFFITT 426
           P F++QGGD T   G GG+SIYG  F  E    L+    G++ MA    + N SQFFIT 
Sbjct: 59  PEFLIQGGDPTG-TGMGGESIYGEPFAVETHPRLRFIRRGLVGMACTENEGNNSQFFITL 117

Query: 427 VKTSWLDGRHVVFGNVV 477
             T   +G+  +FG VV
Sbjct: 118 GPTPEWNGKQTLFGRVV 134



 Score = 41.5 bits (93), Expect = 1e-04
 Identities = 25/57 (43%), Positives = 31/57 (54%)
 Frame = +2

Query: 131 GKIVIELRSDVTPKTCENFRALCTGEKGFGYKGSIFHRVIPISCCKEGTSPTITALG 301
           G I IEL     PK C NF  LC   +G+ Y G+I HRV+P     +G  PT T +G
Sbjct: 22  GDIQIELWCKEVPKACRNFIQLCL--EGY-YDGTIVHRVVP-EFLIQGGDPTGTGMG 74


>SPBC17G9.05 |rct1|cyp6|RRM-containing cyclophilin regulating
           transcription Rct1|Schizosaccharomyces pombe|chr
           2|||Manual
          Length = 432

 Score = 31.5 bits (68), Expect = 0.12
 Identities = 13/27 (48%), Positives = 17/27 (62%)
 Frame = +2

Query: 119 DAPLGKIVIELRSDVTPKTCENFRALC 199
           +  +G +VI+L     PKTCENF  LC
Sbjct: 6   ETTVGDLVIDLFVKEAPKTCENFLKLC 32


>SPBP8B7.07c |set6||histone lysine methyltransferase Set6
           |Schizosaccharomyces pombe|chr 2|||Manual
          Length = 483

 Score = 27.1 bits (57), Expect = 2.6
 Identities = 11/32 (34%), Positives = 16/32 (50%)
 Frame = +2

Query: 107 VTVDDAPLGKIVIELRSDVTPKTCENFRALCT 202
           V  D+ P+GKI+I  R D+      N    C+
Sbjct: 19  VATDNIPIGKIIIRKRVDILSLDSANLTRTCS 50


>SPBC21B10.09 |||acetyl-CoA transporter |Schizosaccharomyces
           pombe|chr 2|||Manual
          Length = 519

 Score = 26.6 bits (56), Expect = 3.5
 Identities = 15/67 (22%), Positives = 30/67 (44%)
 Frame = +2

Query: 155 SDVTPKTCENFRALCTGEKGFGYKGSIFHRVIPISCCKEGTSPTITALGESPSTAISLKT 334
           +D   K C+     C  ++   Y  SI    + IS C    +P +  L ++P ++  + +
Sbjct: 453 ADAQKKECQALGGTCLYKRDGYYLTSIVGIFLAISICVSLITPVVRRLTKAPISSWHIHS 512

Query: 335 RISPLST 355
           +I+   T
Sbjct: 513 KIAETYT 519


>SPCC285.13c |||nucleoporin Nup60 |Schizosaccharomyces pombe|chr
           3|||Manual
          Length = 736

 Score = 26.6 bits (56), Expect = 3.5
 Identities = 14/36 (38%), Positives = 21/36 (58%)
 Frame = +2

Query: 266 KEGTSPTITALGESPSTAISLKTRISPLSTLDLASS 373
           KE  +P+ITA   SP +A S  + ISP +   + +S
Sbjct: 334 KEKNTPSITAKAGSPQSAPSKASYISPYARPGITTS 369


>SPAC110.03 |cdc42||Rho family GTPase Cdc42|Schizosaccharomyces
           pombe|chr 1|||Manual
          Length = 192

 Score = 26.6 bits (56), Expect = 3.5
 Identities = 7/9 (77%), Positives = 8/9 (88%)
 Frame = +3

Query: 402 WFPVLHHHC 428
           WFP +HHHC
Sbjct: 97  WFPEVHHHC 105


>SPAC17D4.04 ||SPAC458.01|tRNA |Schizosaccharomyces pombe|chr
           1|||Manual
          Length = 654

 Score = 26.2 bits (55), Expect = 4.6
 Identities = 15/50 (30%), Positives = 25/50 (50%)
 Frame = -1

Query: 497 LTTSMPSTTFPKTTCLPSSQEVLTVVMKNWEPLVSAPALAMERTPGPVCL 348
           LT  +P TTF  T  +P + +V    ++++ PL+        + P PV L
Sbjct: 37  LTEQLP-TTFRITASIPHATQVRDYFIEHYYPLIENARTEDAKIPLPVSL 85


>SPAP7G5.06 |||amino acid permease, unknown 4|Schizosaccharomyces
           pombe|chr 1|||Manual
          Length = 583

 Score = 25.8 bits (54), Expect = 6.1
 Identities = 16/50 (32%), Positives = 23/50 (46%), Gaps = 1/50 (2%)
 Frame = +1

Query: 274 DFTNHNGTGGKSIYGNKFEDEN-FTLKHTGPGVLSMANAGADTNGSQFFI 420
           D   +  T  KS+YG   +D+N F +  T   V+      ADT   Q F+
Sbjct: 11  DLEKYPSTATKSVYGQSKDDKNVFDIHPTESEVIPGEVEYADTPSHQNFL 60


>SPCC16A11.08 |atg20||sorting nexin Atg20|Schizosaccharomyces
           pombe|chr 3|||Manual
          Length = 534

 Score = 25.4 bits (53), Expect = 8.1
 Identities = 22/70 (31%), Positives = 30/70 (42%), Gaps = 6/70 (8%)
 Frame = -3

Query: 486 HAFNNIPKDNMSAIQPGGLDSGDEELGTISISTGISHGEDARSSVLKG------EILVFK 325
           H  N  P    +   P   +S   EL      + IS+G+DA S VLK       E++V +
Sbjct: 228 HELNESPSTPTAPDFPH-YNSSPSELSPTQRRSSISNGKDAPSPVLKDLTSYTQEVIVCR 286

Query: 324 LIAVDGLSPS 295
                 LSPS
Sbjct: 287 KFLHHSLSPS 296


>SPBC12C2.10c |pst1|SPBC21D10.01c|Clr6 histone deacetylase complex
           subunit Pst1|Schizosaccharomyces pombe|chr 2|||Manual
          Length = 1522

 Score = 25.4 bits (53), Expect = 8.1
 Identities = 19/64 (29%), Positives = 30/64 (46%), Gaps = 1/64 (1%)
 Frame = +2

Query: 140 VIELRSDVTPKTCENFRALCTGEKGFGYKG-SIFHRVIPISCCKEGTSPTITALGESPST 316
           ++++ +D   K  E  +A  T     G K  SI+H+VI     KE     I  L ++PS 
Sbjct: 675 LLQIHADKMLKMSEVEKANWTLPSNLGGKSVSIYHKVIKKVYGKEHAQQIIENLQKNPSV 734

Query: 317 AISL 328
            I +
Sbjct: 735 TIPI 738


  Database: spombe
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 2,362,478
  Number of sequences in database:  5004
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 3,194,391
Number of Sequences: 5004
Number of extensions: 70823
Number of successful extensions: 252
Number of sequences better than 10.0: 17
Number of HSP's better than 10.0 without gapping: 226
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 241
length of database: 2,362,478
effective HSP length: 71
effective length of database: 2,007,194
effective search space used: 331187010
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -