SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS20007
         (719 letters)

Database: spombe 
           5004 sequences; 2,362,478 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SPBC530.10c |anc1||adenine nucleotide carrier Anc1|Schizosacchar...    87   3e-18
SPAPB17E12.12c |||mitochondrial transporter|Schizosaccharomyces ...    44   3e-05
SPAC17H9.08 |||mitochondrial coenzyme A transporter|Schizosaccha...    41   2e-04
SPBC12D12.05c |||mitochondrial carrier, calcium binding subfamil...    34   0.023
SPAC139.02c |oac1||anion transporter|Schizosaccharomyces pombe|c...    34   0.023
SPAC4G9.20c |||mitochondrial carrier with solute carrier repeats...    33   0.031
SPCC1442.03 ||SPCC1450.19|ATP-Mg/Pi carrier homolog|Schizosaccha...    32   0.072
SPAC8C9.12c |||iron ion transporter |Schizosaccharomyces pombe|c...    31   0.22 
SPAC688.09 |||pyrimidine nucletide transporter |Schizosaccharomy...    30   0.29 
SPBC1604.04 |||thiamine pyrophosphate transporter|Schizosaccharo...    29   0.67 
SPAC21E11.06 |tif224||translation initiation factor eIF2B delta ...    28   1.5  
SPAC19G12.07c |rsd1||RNA-binding protein Rsd1|Schizosaccharomyce...    28   1.5  
SPAC227.03c |||mitochondrial NAD+ transporter|Schizosaccharomyce...    28   1.5  
SPAC328.09 |||2-oxoadipate and 2-oxoglutarate transporter |Schiz...    27   2.0  
SPBC83.13 |||mitochondrial tricarboxylic acid transporter|Schizo...    26   6.2  
SPBC29A3.11c |||mitochondrial carboxylic acid transporter|Schizo...    26   6.2  
SPAC4G8.08 |||iron ion transporter |Schizosaccharomyces pombe|ch...    26   6.2  
SPAC17H9.10c |ddb1||damaged DNA binding protein Ddb1 |Schizosacc...    26   6.2  
SPCC18B5.05c |||phosphomethylpyrimidine kinase |Schizosaccharomy...    25   8.2  

>SPBC530.10c |anc1||adenine nucleotide carrier
           Anc1|Schizosaccharomyces pombe|chr 2|||Manual
          Length = 322

 Score = 86.6 bits (205), Expect = 3e-18
 Identities = 45/89 (50%), Positives = 57/89 (64%), Gaps = 2/89 (2%)
 Frame = +2

Query: 248 GSLSFWRGNFANVIRYFPTQALNFAFKDKYKQVFLGGVDKKTQFWRYFXXXXXXXXXXXX 427
           G +S WRGN ANV+RYFPTQALNFAFKDK+K++F G   ++  + ++F            
Sbjct: 86  GVISLWRGNTANVLRYFPTQALNFAFKDKFKKMF-GYKKERDGYAKWFAGNLASGGAAGA 144

Query: 428 TSLCFVYPLDFARTRLAADV--GKGDGQR 508
            SL FVY LD+ARTRLA D    K  G+R
Sbjct: 145 ASLLFVYSLDYARTRLANDAKSAKKGGER 173



 Score = 61.7 bits (143), Expect = 1e-10
 Identities = 33/61 (54%), Positives = 41/61 (67%), Gaps = 1/61 (1%)
 Frame = +3

Query: 75  FAKDFLAGGISAAVSKTAVAPIERVKLLLQVQ-HVSKQIAADQRYKGIVDAFVRIPKEQG 251
           F  DF+ GG+SAAVSKTA APIERVKLL+Q Q  + +      RYKGI + F R   E+G
Sbjct: 27  FFFDFMMGGVSAAVSKTAAAPIERVKLLIQNQDEMIRAGRLSHRYKGIGECFKRTAAEEG 86

Query: 252 L 254
           +
Sbjct: 87  V 87



 Score = 35.5 bits (78), Expect = 0.008
 Identities = 15/25 (60%), Positives = 19/25 (76%)
 Frame = +1

Query: 511 FSGLGNCISKIFKSDGLIGLYRGFG 585
           F+GL +   K ++SDGL GLYRGFG
Sbjct: 175 FNGLVDVYRKTYRSDGLRGLYRGFG 199



 Score = 27.5 bits (58), Expect = 2.0
 Identities = 14/60 (23%), Positives = 29/60 (48%)
 Frame = +3

Query: 75  FAKDFLAGGISAAVSKTAVAPIERVKLLLQVQHVSKQIAADQRYKGIVDAFVRIPKEQGL 254
           FA +  +GG + A S   V  ++  +  L     S +   ++++ G+VD + +  +  GL
Sbjct: 132 FAGNLASGGAAGAASLLFVYSLDYARTRLANDAKSAKKGGERQFNGLVDVYRKTYRSDGL 191



 Score = 27.5 bits (58), Expect = 2.0
 Identities = 9/16 (56%), Positives = 12/16 (75%)
 Frame = +3

Query: 600 IIIYRASYFGFYDTAR 647
           I++YR  YFG YDT +
Sbjct: 205 IVVYRGLYFGMYDTLK 220



 Score = 25.8 bits (54), Expect = 6.2
 Identities = 8/23 (34%), Positives = 14/23 (60%)
 Frame = +1

Query: 511 FSGLGNCISKIFKSDGLIGLYRG 579
           + G+G C  +    +G+I L+RG
Sbjct: 71  YKGIGECFKRTAAEEGVISLWRG 93


>SPAPB17E12.12c |||mitochondrial transporter|Schizosaccharomyces
           pombe|chr 1|||Manual
          Length = 317

 Score = 43.6 bits (98), Expect = 3e-05
 Identities = 21/55 (38%), Positives = 36/55 (65%)
 Frame = +3

Query: 90  LAGGISAAVSKTAVAPIERVKLLLQVQHVSKQIAADQRYKGIVDAFVRIPKEQGL 254
           L+GG++A VS+TAV+P+ER+K++ QVQ+       ++ Y  +    V+I   +GL
Sbjct: 25  LSGGVAATVSRTAVSPLERMKIIFQVQN-------NKEYTSLTSTLVKIWNREGL 72



 Score = 25.8 bits (54), Expect = 6.2
 Identities = 10/25 (40%), Positives = 17/25 (68%)
 Frame = +1

Query: 511 FSGLGNCISKIFKSDGLIGLYRGFG 585
           ++ L + + KI+  +GLIG +RG G
Sbjct: 56  YTSLTSTLVKIWNREGLIGFFRGNG 80


>SPAC17H9.08 |||mitochondrial coenzyme A
           transporter|Schizosaccharomyces pombe|chr 1|||Manual
          Length = 326

 Score = 40.7 bits (91), Expect = 2e-04
 Identities = 23/58 (39%), Positives = 33/58 (56%)
 Frame = +3

Query: 81  KDFLAGGISAAVSKTAVAPIERVKLLLQVQHVSKQIAADQRYKGIVDAFVRIPKEQGL 254
           K  +AGG +  V+K+ VAP++RVK+L Q  H S +  A  R+ G+  A   I    GL
Sbjct: 19  KSGIAGGTAGCVAKSVVAPLDRVKILYQTNHASYRGYAYSRH-GLYKAIKHIYHVYGL 75



 Score = 30.7 bits (66), Expect = 0.22
 Identities = 19/77 (24%), Positives = 34/77 (44%)
 Frame = +2

Query: 248 GSLSFWRGNFANVIRYFPTQALNFAFKDKYKQVFLGGVDKKTQFWRYFXXXXXXXXXXXX 427
           G    ++G+ A + R FP   + F   ++ ++V +   + +T   R+             
Sbjct: 74  GLHGLYQGHTATLYRVFPYAGIKFVAYEQVRRVLIRDPEHETHARRFLSGSLAGTC---- 129

Query: 428 TSLCFVYPLDFARTRLA 478
            S+ F YPL+  R RLA
Sbjct: 130 -SVFFTYPLELIRVRLA 145


>SPBC12D12.05c |||mitochondrial carrier, calcium binding
           subfamily|Schizosaccharomyces pombe|chr 2|||Manual
          Length = 426

 Score = 33.9 bits (74), Expect = 0.023
 Identities = 14/33 (42%), Positives = 23/33 (69%)
 Frame = +3

Query: 63  DPVAFAKDFLAGGISAAVSKTAVAPIERVKLLL 161
           DP      F++GGI+  VS+T  AP++R+K++L
Sbjct: 123 DPKNNVGYFISGGIAGIVSRTCTAPLDRLKVML 155



 Score = 27.1 bits (57), Expect = 2.7
 Identities = 9/32 (28%), Positives = 22/32 (68%)
 Frame = +3

Query: 87  FLAGGISAAVSKTAVAPIERVKLLLQVQHVSK 182
           +LAGG++ +V++  + P++ +K  +Q   +S+
Sbjct: 232 YLAGGMAGSVAQMFIYPVDTLKFRIQCSDLSR 263


>SPAC139.02c |oac1||anion transporter|Schizosaccharomyces pombe|chr
           1|||Manual
          Length = 320

 Score = 33.9 bits (74), Expect = 0.023
 Identities = 18/57 (31%), Positives = 32/57 (56%), Gaps = 1/57 (1%)
 Frame = +3

Query: 87  FLAGGISAAVSKTAVAPIERVKLLLQVQ-HVSKQIAADQRYKGIVDAFVRIPKEQGL 254
           FL+GG++A  + T   P E +K   Q+Q  ++K   + + YK +  AF  I + +G+
Sbjct: 27  FLSGGLAACGAVTLTNPFEVIKTRFQLQGQLTKLDPSKRIYKSVGQAFSLIARHEGI 83



 Score = 28.7 bits (61), Expect = 0.88
 Identities = 10/20 (50%), Positives = 14/20 (70%)
 Frame = +1

Query: 526 NCISKIFKSDGLIGLYRGFG 585
           +CI K  +S+G   LY+GFG
Sbjct: 271 DCILKTIRSEGFFALYKGFG 290


>SPAC4G9.20c |||mitochondrial carrier with solute carrier
           repeats|Schizosaccharomyces pombe|chr 1|||Manual
          Length = 302

 Score = 33.5 bits (73), Expect = 0.031
 Identities = 26/70 (37%), Positives = 36/70 (51%), Gaps = 3/70 (4%)
 Frame = +3

Query: 72  AFAKDFLAGGISAAVSKTAVA-PIERVKLLLQVQHVSKQIAADQRYKGIVDAFVRIPKEQ 248
           +F KDFLA G+S  V++  V  P + VK+ LQ Q     I     Y   +D   +I K +
Sbjct: 16  SFTKDFLA-GVSGGVAQVLVGQPFDCVKVRLQSQSNVSPI-----YNNALDCVKKISKNE 69

Query: 249 GL--FHSGVV 272
           GL  F+ G V
Sbjct: 70  GLAAFYKGTV 79



 Score = 33.1 bits (72), Expect = 0.041
 Identities = 21/69 (30%), Positives = 35/69 (50%)
 Frame = +3

Query: 66  PVAFAKDFLAGGISAAVSKTAVAPIERVKLLLQVQHVSKQIAADQRYKGIVDAFVRIPKE 245
           PV   + +++G IS   +   V P+E V++ LQ+Q   K +     Y G  D   +I  +
Sbjct: 109 PVTMPQYYVSGAISGLANSFLVGPVEHVRIRLQIQ-TGKNVL----YHGPWDCIKKISSQ 163

Query: 246 QGLFHSGVV 272
            GL  SG++
Sbjct: 164 YGL--SGIM 170


>SPCC1442.03 ||SPCC1450.19|ATP-Mg/Pi carrier
           homolog|Schizosaccharomyces pombe|chr 3|||Manual
          Length = 338

 Score = 32.3 bits (70), Expect = 0.072
 Identities = 11/23 (47%), Positives = 19/23 (82%)
 Frame = +1

Query: 517 GLGNCISKIFKSDGLIGLYRGFG 585
           G+ + +  ++KS+GL+GL+RGFG
Sbjct: 283 GIRHVLGGLYKSEGLLGLFRGFG 305



 Score = 27.1 bits (57), Expect = 2.7
 Identities = 17/63 (26%), Positives = 30/63 (47%)
 Frame = +3

Query: 72  AFAKDFLAGGISAAVSKTAVAPIERVKLLLQVQHVSKQIAADQRYKGIVDAFVRIPKEQG 251
           A++   +AGGI  A +   +  ++ VK   Q    +       +Y G+V  +  I  E+G
Sbjct: 14  AYSHVLIAGGIGGATADFLMHSLDTVKTRQQAALYTN------KYNGMVKCYSTILCEEG 67

Query: 252 LFH 260
           +FH
Sbjct: 68  VFH 70


>SPAC8C9.12c |||iron ion transporter |Schizosaccharomyces pombe|chr
           1|||Manual
          Length = 303

 Score = 30.7 bits (66), Expect = 0.22
 Identities = 15/44 (34%), Positives = 27/44 (61%)
 Frame = +3

Query: 90  LAGGISAAVSKTAVAPIERVKLLLQVQHVSKQIAADQRYKGIVD 221
           ++GG+S A++ +   P++ VK LLQ +  S  I   ++ KG +D
Sbjct: 209 ISGGLSGAIASSLTTPLDVVKTLLQTRG-SSSIPEVRKCKGSLD 251



 Score = 25.4 bits (53), Expect = 8.2
 Identities = 13/57 (22%), Positives = 33/57 (57%), Gaps = 1/57 (1%)
 Frame = +3

Query: 90  LAGGISAAVSKTAVAPIERVKLLLQVQH-VSKQIAADQRYKGIVDAFVRIPKEQGLF 257
           LAG  S  +  + + P++ +K  +Q+ + VS+ ++ +     IV++ ++I   +G++
Sbjct: 24  LAGAFSGILEHSVMYPVDAIKTRMQMLNGVSRSVSGN-----IVNSVIKISSTEGVY 75


>SPAC688.09 |||pyrimidine nucletide transporter |Schizosaccharomyces
           pombe|chr 1|||Manual
          Length = 361

 Score = 30.3 bits (65), Expect = 0.29
 Identities = 17/47 (36%), Positives = 26/47 (55%)
 Frame = +3

Query: 24  VKIT*SNKMSNLADPVAFAKDFLAGGISAAVSKTAVAPIERVKLLLQ 164
           V +T +N  SN   P   +  F+AGG++  +   A AP++ VK  LQ
Sbjct: 32  VLLTKANNASNERAPPPLSH-FIAGGVAGMLGAIATAPLDVVKTRLQ 77


>SPBC1604.04 |||thiamine pyrophosphate
           transporter|Schizosaccharomyces pombe|chr 2|||Manual
          Length = 314

 Score = 29.1 bits (62), Expect = 0.67
 Identities = 11/30 (36%), Positives = 20/30 (66%)
 Frame = +3

Query: 90  LAGGISAAVSKTAVAPIERVKLLLQVQHVS 179
           LAGGIS+ + +  +AP + +K+ +Q+   S
Sbjct: 21  LAGGISSVICRFMIAPFDVIKIRMQITQSS 50


>SPAC21E11.06 |tif224||translation initiation factor eIF2B delta
           subunit|Schizosaccharomyces pombe|chr 1|||Manual
          Length = 467

 Score = 27.9 bits (59), Expect = 1.5
 Identities = 12/26 (46%), Positives = 18/26 (69%)
 Frame = +2

Query: 476 AADVGKGDGQRNSPVSETASARSSSP 553
           +A+  K DG+  SPVSE++S   +SP
Sbjct: 4   SAEQAKKDGKDQSPVSESSSVGGTSP 29


>SPAC19G12.07c |rsd1||RNA-binding protein Rsd1|Schizosaccharomyces
           pombe|chr 1|||Manual
          Length = 604

 Score = 27.9 bits (59), Expect = 1.5
 Identities = 18/55 (32%), Positives = 25/55 (45%)
 Frame = -1

Query: 515 ENYAGHLPYRHRRRDGYVRSRGGTRSTERWLRRHHRRPDYQRSNARTASSCQRRR 351
           +++    P R R RD   RS   +RS     R  HR  DY RS   ++   + RR
Sbjct: 138 DSHQSRSPVRSRDRD---RSSRSSRSRHPSSRSRHRYDDYSRSPPYSSRHSRSRR 189


>SPAC227.03c |||mitochondrial NAD+ transporter|Schizosaccharomyces
           pombe|chr 1|||Manual
          Length = 371

 Score = 27.9 bits (59), Expect = 1.5
 Identities = 13/30 (43%), Positives = 17/30 (56%)
 Frame = +3

Query: 81  KDFLAGGISAAVSKTAVAPIERVKLLLQVQ 170
           KD +AGG +   S   VAP++ VK   Q Q
Sbjct: 7   KDAIAGGAAGLASSLVVAPLDVVKTRKQAQ 36


>SPAC328.09 |||2-oxoadipate and 2-oxoglutarate transporter
           |Schizosaccharomyces pombe|chr 1|||Manual
          Length = 298

 Score = 27.5 bits (58), Expect = 2.0
 Identities = 19/58 (32%), Positives = 27/58 (46%), Gaps = 1/58 (1%)
 Frame = +3

Query: 78  AKDFLAGGISAAVSKTAVAPIERVKLLLQ-VQHVSKQIAADQRYKGIVDAFVRIPKEQ 248
           A   L G  +       V P E +K+ LQ V++ SK       Y G VD F +I K++
Sbjct: 105 ALSILTGSCAGFTETFVVVPFELMKIRLQDVKNASK-------YNGTVDCFTKIVKQE 155



 Score = 27.1 bits (57), Expect = 2.7
 Identities = 10/19 (52%), Positives = 13/19 (68%)
 Frame = +2

Query: 443 VYPLDFARTRLAADVGKGD 499
           +YPLD  +TR+   VGK D
Sbjct: 26  LYPLDVVKTRMQLSVGKSD 44



 Score = 25.8 bits (54), Expect = 6.2
 Identities = 10/23 (43%), Positives = 16/23 (69%)
 Frame = +1

Query: 511 FSGLGNCISKIFKSDGLIGLYRG 579
           ++G  +C+ KI K++G   LYRG
Sbjct: 45  YNGTFDCLKKIVKNEGPHRLYRG 67


>SPBC83.13 |||mitochondrial tricarboxylic acid
           transporter|Schizosaccharomyces pombe|chr 2|||Manual
          Length = 293

 Score = 25.8 bits (54), Expect = 6.2
 Identities = 10/21 (47%), Positives = 15/21 (71%)
 Frame = +1

Query: 517 GLGNCISKIFKSDGLIGLYRG 579
           G+   I  I+K++G+ GLYRG
Sbjct: 245 GIMQTIMSIYKNNGIKGLYRG 265


>SPBC29A3.11c |||mitochondrial carboxylic acid
           transporter|Schizosaccharomyces pombe|chr 2|||Manual
          Length = 297

 Score = 25.8 bits (54), Expect = 6.2
 Identities = 10/23 (43%), Positives = 14/23 (60%)
 Frame = +1

Query: 511 FSGLGNCISKIFKSDGLIGLYRG 579
           F  + +C     K++GL GLYRG
Sbjct: 50  FPTIRSCFQNAVKNEGLKGLYRG 72


>SPAC4G8.08 |||iron ion transporter |Schizosaccharomyces pombe|chr
           1|||Manual
          Length = 271

 Score = 25.8 bits (54), Expect = 6.2
 Identities = 10/19 (52%), Positives = 14/19 (73%)
 Frame = +1

Query: 526 NCISKIFKSDGLIGLYRGF 582
           N IS + +S+GL G YRG+
Sbjct: 121 NTISTLARSEGLKGFYRGY 139


>SPAC17H9.10c |ddb1||damaged DNA binding protein Ddb1
           |Schizosaccharomyces pombe|chr 1|||Manual
          Length = 1072

 Score = 25.8 bits (54), Expect = 6.2
 Identities = 13/36 (36%), Positives = 20/36 (55%)
 Frame = -2

Query: 229 TKASTIPL*RWSAAICLLTCCTWSSSLTRSIGATAV 122
           T+ + + +  WSA I +LT C    SLT S+  T +
Sbjct: 533 TEENVVYVGLWSADIIMLTYCQDGISLTHSLKLTDI 568


>SPCC18B5.05c |||phosphomethylpyrimidine kinase |Schizosaccharomyces
           pombe|chr 3|||Manual
          Length = 327

 Score = 25.4 bits (53), Expect = 8.2
 Identities = 8/12 (66%), Positives = 11/12 (91%)
 Frame = +3

Query: 648 GMLPDPKNTPIV 683
           GMLPDPK+ P++
Sbjct: 89  GMLPDPKSIPVI 100


  Database: spombe
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 2,362,478
  Number of sequences in database:  5004
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 2,471,355
Number of Sequences: 5004
Number of extensions: 43012
Number of successful extensions: 187
Number of sequences better than 10.0: 19
Number of HSP's better than 10.0 without gapping: 158
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 185
length of database: 2,362,478
effective HSP length: 71
effective length of database: 2,007,194
effective search space used: 337208592
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -