SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS20004
         (768 letters)

Database: spombe 
           5004 sequences; 2,362,478 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SPBC1289.03c |spi1||Ran GTPase Spi1|Schizosaccharomyces pombe|ch...   197   1e-51
SPAC110.03 |cdc42||Rho family GTPase Cdc42|Schizosaccharomyces p...    62   8e-11
SPBC1703.10 |ypt1||GTPase Ypt1|Schizosaccharomyces pombe|chr 2||...    60   3e-10
SPAC4C5.02c |ryh1|hos1|GTPase Ryh1|Schizosaccharomyces pombe|chr...    56   6e-09
SPAC18G6.03 |ypt3||GTPase Ypt3|Schizosaccharomyces pombe|chr 1||...    50   3e-07
SPAC16A10.04 |rho4||Rho family GTPase Rho4|Schizosaccharomyces p...    49   8e-07
SPAC9E9.07c |ypt2||GTPase Ypt2 |Schizosaccharomyces pombe|chr 1|...    48   2e-06
SPBC405.04c |ypt7||GTPase Ypt7|Schizosaccharomyces pombe|chr 2||...    47   3e-06
SPAC6F6.15 |ypt5||GTPase Ypt5|Schizosaccharomyces pombe|chr 1|||...    46   8e-06
SPAC16.01 |rho2||Rho family GTPase Rho2|Schizosaccharomyces pomb...    44   3e-05
SPAC17H9.09c |ras1|ste5|GTPase Ras1|Schizosaccharomyces pombe|ch...    44   3e-05
SPAC20H4.11c |rho5||Rho family GTPase Rho5|Schizosaccharomyces p...    42   1e-04
SPAC1565.06c |spg1|sid3|GTPase Spg1|Schizosaccharomyces pombe|ch...    42   1e-04
SPAC23C4.08 |rho3||Rho family GTPase Rho3|Schizosaccharomyces po...    40   3e-04
SPAPB1A10.10c |ypt71||GTPase Ypt71|Schizosaccharomyces pombe|chr...    40   3e-04
SPAC1F7.04 |rho1||Rho family GTPase Rho1|Schizosaccharomyces pom...    38   0.002
SPAC1B3.11c |ypt4||GTPase Ypt4|Schizosaccharomyces pombe|chr 1||...    38   0.002
SPAC17C9.05c |pmc3|prk1, med27|mediator complex subunit Pmc3 |Sc...    31   0.18 
SPCC320.04c |||GTPase Gem1 |Schizosaccharomyces pombe|chr 3|||Ma...    30   0.32 
SPBC119.15 |||AAA family ATPase, unknown biological role|Schizos...    29   0.73 
SPAC19D5.03 |cid1||poly|Schizosaccharomyces pombe|chr 1|||Manual       29   0.97 
SPBC1539.08 |||ADP-ribosylation factor, Arf family|Schizosacchar...    28   1.3  
SPBC14F5.06 |||iron-sulfur protein|Schizosaccharomyces pombe|chr...    28   1.7  
SPBC4F6.18c |arf1||ADP-ribosylation factor Arf1|Schizosaccharomy...    27   2.2  
SPAC24H6.13 |||DUF221 family protein|Schizosaccharomyces pombe|c...    27   2.2  
SPAC26F1.08c |||conserved protein|Schizosaccharomyces pombe|chr ...    26   5.2  
SPCC737.08 |||midasin |Schizosaccharomyces pombe|chr 3|||Manual        25   9.0  
SPAC17A5.14 |exo2||exonuclease II Exo2 |Schizosaccharomyces pomb...    25   9.0  
SPAC1A6.11 |||dubious|Schizosaccharomyces pombe|chr 1|||Manual         25   9.0  
SPBC530.08 |||transcription factor |Schizosaccharomyces pombe|ch...    25   9.0  
SPAC29B12.01 |ino80|SPAC3G6.12|SNF2 family helicase Ino80|Schizo...    25   9.0  

>SPBC1289.03c |spi1||Ran GTPase Spi1|Schizosaccharomyces pombe|chr
           2|||Manual
          Length = 216

 Score =  197 bits (481), Expect = 1e-51
 Identities = 93/136 (68%), Positives = 104/136 (76%)
 Frame = +2

Query: 101 DMPTFKCVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTNRGQFVLMCGTQ 280
           ++PTFK VLVGDGGTGKTTFVKRHLTGEFEKKY+ATLGVEVHPL FHTN G+        
Sbjct: 6   NVPTFKLVLVGDGGTGKTTFVKRHLTGEFEKKYIATLGVEVHPLHFHTNFGEICFNVWDT 65

Query: 281 PDKRSLVVLETDTIFKDNVLSVMFDVTSRVTYKNVPNWHRDLVRVCEGIPIVLCGNKVDI 460
             +  L  L      +     +MFDVTSR+TYKNVP+W RDLVRVCE IPIVLCGNKVD+
Sbjct: 66  AGQEKLGGLRDGYYIQGQCGIIMFDVTSRITYKNVPHWWRDLVRVCENIPIVLCGNKVDV 125

Query: 461 KDRKVKAKTIVFHRKK 508
           K+RKVKAK I FHRKK
Sbjct: 126 KERKVKAKAITFHRKK 141



 Score =  130 bits (315), Expect = 2e-31
 Identities = 70/135 (51%), Positives = 81/135 (60%)
 Frame = +1

Query: 256 IRFNVWDTAGQEKFGGLRDGYYIQGQCAISHVRRNLSSYVQKCT*LA*RFGPCM*RYPYC 435
           I FNVWDTAGQEK GGLRDGYYIQGQC I           +                P  
Sbjct: 58  ICFNVWDTAGQEKLGGLRDGYYIQGQCGIIMFDVTSRITYKNVPHWWRDLVRVCENIPIV 117

Query: 436 LVRKQSGY*RQKS*GENYCFPQEKDLQYYDISAKSNYNFEKPFLWLARKLIGDGNLEFVA 615
           L   +     +K   +   F ++K+LQYYDISAKSNYNFEKPFLWLARKL+G+ NLEFVA
Sbjct: 118 LCGNKVDVKERKVKAKAITFHRKKNLQYYDISAKSNYNFEKPFLWLARKLVGNPNLEFVA 177

Query: 616 MPALLPPEVTMGSSM 660
            PAL PPEV +   +
Sbjct: 178 SPALAPPEVQVDQQL 192


>SPAC110.03 |cdc42||Rho family GTPase Cdc42|Schizosaccharomyces
           pombe|chr 1|||Manual
          Length = 192

 Score = 62.1 bits (144), Expect = 8e-11
 Identities = 35/122 (28%), Positives = 60/122 (49%), Gaps = 1/122 (0%)
 Frame = +2

Query: 104 MPTFKCVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTNRGQFVLMCGTQP 283
           MPT KCV+VGDG  GKT  +  + T +F   YV T+  + + +        + L      
Sbjct: 1   MPTIKCVVVGDGAVGKTCLLISYTTNKFPSDYVPTV-FDNYAVTVMIGDEPYTLGLFDTA 59

Query: 284 DKRSLVVLETDTIFKDNVLSVMFDVTSRVTYKNV-PNWHRDLVRVCEGIPIVLCGNKVDI 460
            +     L   +  + +V  V F VTS  +++NV   W  ++   C G+P ++ G ++D+
Sbjct: 60  GQEDYDRLRPLSYPQTDVFLVCFSVTSPASFENVKEKWFPEVHHHCPGVPCLIVGTQIDL 119

Query: 461 KD 466
           +D
Sbjct: 120 RD 121


>SPBC1703.10 |ypt1||GTPase Ypt1|Schizosaccharomyces pombe|chr
           2|||Manual
          Length = 203

 Score = 60.1 bits (139), Expect = 3e-10
 Identities = 32/122 (26%), Positives = 60/122 (49%), Gaps = 1/122 (0%)
 Frame = +2

Query: 113 FKCVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTNRGQFVLMCGTQPDKR 292
           FK +L+GD G GK+  + R     + + Y++T+GV+     F        L       + 
Sbjct: 9   FKLLLIGDSGVGKSCLLLRFADDTYTESYISTIGVDFKIRTFELEGKTVKLQIWDTAGQE 68

Query: 293 SLVVLETDTIFKDNVLSVMFDVTSRVTYKNVPNWHRDLVR-VCEGIPIVLCGNKVDIKDR 469
               + +      + + +++DVT + ++ NV  W +++ R   EG+  +L GNK D+ D+
Sbjct: 69  RFRTITSSYYRGAHGIIIVYDVTDQDSFNNVKQWLQEIDRYAVEGVNRLLVGNKSDMVDK 128

Query: 470 KV 475
           KV
Sbjct: 129 KV 130


>SPAC4C5.02c |ryh1|hos1|GTPase Ryh1|Schizosaccharomyces pombe|chr
           1|||Manual
          Length = 201

 Score = 56.0 bits (129), Expect = 6e-09
 Identities = 34/123 (27%), Positives = 66/123 (53%), Gaps = 3/123 (2%)
 Frame = +2

Query: 113 FKCVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVE-VHPLVFHTNRGQFVLMCGTQPDK 289
           FK V +G+   GKT+ + R +  +F+  Y AT+G++ +   ++  +R   + +  T   +
Sbjct: 12  FKLVFLGEQSVGKTSLITRFMYDQFDNTYQATIGIDFLSKTMYLEDRTVRLQLWDTAGQE 71

Query: 290 RSLVVLETDTIFKDNVLSVMFDVTSRVTYKNVPNWHRDLVRVCEG--IPIVLCGNKVDIK 463
           R   ++ +  I   +V  +++D+T+  ++ N   W  D VR   G  + IVL GNK D+ 
Sbjct: 72  RFRSLIPS-YIRDSSVAIIVYDITNHNSFVNTEKWIED-VRAERGDDVIIVLVGNKTDLA 129

Query: 464 DRK 472
           D++
Sbjct: 130 DKR 132


>SPAC18G6.03 |ypt3||GTPase Ypt3|Schizosaccharomyces pombe|chr
           1|||Manual
          Length = 214

 Score = 50.4 bits (115), Expect = 3e-07
 Identities = 34/119 (28%), Positives = 59/119 (49%), Gaps = 3/119 (2%)
 Frame = +2

Query: 113 FKCVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPL-VFHTNRGQFVLMCGTQPDK 289
           FK VL+GD G GK+  + R    EF  +  +T+GVE     +   N+     +  T   +
Sbjct: 11  FKTVLIGDSGVGKSNLLMRFTRNEFNIESKSTIGVEFATRNIVLDNKKIKAQIWDTAGQE 70

Query: 290 RSLVVLETDTIFKDNV-LSVMFDVTSRVTYKNVPNWHRDLVRVCE-GIPIVLCGNKVDI 460
           R   +  T   ++  V   +++D+T + ++ NV  W ++L    +  I I+L GNK D+
Sbjct: 71  RYRAI--TSAYYRGAVGALIVYDITKQSSFDNVGRWLKELREHADSNIVIMLVGNKTDL 127


>SPAC16A10.04 |rho4||Rho family GTPase Rho4|Schizosaccharomyces
           pombe|chr 1|||Manual
          Length = 203

 Score = 48.8 bits (111), Expect = 8e-07
 Identities = 35/121 (28%), Positives = 54/121 (44%), Gaps = 3/121 (2%)
 Frame = +2

Query: 116 KCVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVE-VHPLVFHTNRGQFVLMCGTQPDKR 292
           K V+VGDGG GKT  +    +G F ++YV T+    +  + +  N     L       + 
Sbjct: 16  KLVVVGDGGCGKTCLLIVFSSGTFPERYVPTVFENYITDITYGPNSKVIELALWDTAGQE 75

Query: 293 SLVVLETDTIFKDNVLSVMFDVTSRVTYKNV-PNWHRDLVRVCEGIPIVLCGNKVDI-KD 466
               L   +    NV+ + F +    +  NV   W+ ++   C   PIVL G K D+ KD
Sbjct: 76  EYDRLRPLSYPNSNVILLCFSIDCPASLNNVTEKWYPEVQHFCPRTPIVLVGLKADLRKD 135

Query: 467 R 469
           R
Sbjct: 136 R 136


>SPAC9E9.07c |ypt2||GTPase Ypt2 |Schizosaccharomyces pombe|chr
           1|||Manual
          Length = 200

 Score = 47.6 bits (108), Expect = 2e-06
 Identities = 26/120 (21%), Positives = 54/120 (45%), Gaps = 1/120 (0%)
 Frame = +2

Query: 116 KCVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTNRGQFVLMCGTQPDKRS 295
           K +L+GD G GK+  + R     F   ++ T+G++        +  +  L       +  
Sbjct: 11  KLLLIGDSGVGKSCLLLRFSEDSFTPSFITTIGIDFKIRTIELDGKRIKLQIWDTAGQER 70

Query: 296 LVVLETDTIFKDNVLSVMFDVTSRVTYKNVPNWHRDLVR-VCEGIPIVLCGNKVDIKDRK 472
              + T        + +++DVT + ++ NV  W  ++ +   E +  +L GNK D +D++
Sbjct: 71  FRTITTAYYRGAMGILLLYDVTDKKSFDNVRTWFSNVEQHASENVYKILIGNKCDCEDQR 130



 Score = 33.5 bits (73), Expect = 0.034
 Identities = 12/30 (40%), Positives = 19/30 (63%)
 Frame = +1

Query: 232 SIPYEPRAIRFNVWDTAGQEKFGGLRDGYY 321
           +I  + + I+  +WDTAGQE+F  +   YY
Sbjct: 50  TIELDGKRIKLQIWDTAGQERFRTITTAYY 79


>SPBC405.04c |ypt7||GTPase Ypt7|Schizosaccharomyces pombe|chr
           2|||Manual
          Length = 205

 Score = 46.8 bits (106), Expect = 3e-06
 Identities = 30/135 (22%), Positives = 64/135 (47%), Gaps = 8/135 (5%)
 Frame = +2

Query: 116 KCVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTNRGQFVLMCGTQPDKRS 295
           K +++G+ G GKT+ + +++  +F K Y AT+G +        +     L       +  
Sbjct: 10  KVIILGESGVGKTSIMNQYVNRKFSKDYKATIGADFLTKEVLVDDKVVTLQLWDTAGQER 69

Query: 296 LVVLETDTIFKDNVLSVMFDVTSRVTYKNVPNWHRD-LVRVC----EGIPIVLCGNKVDI 460
              L        +   +++DV +  +++ + +W  + L++      E  P +L GNKVD+
Sbjct: 70  FQSLGVAFYRGADCCVLVYDVNNSKSFETLDSWRDEFLIQASPSNPETFPFILLGNKVDV 129

Query: 461 KDRK---VKAKTIVF 496
           +++K    K+K + F
Sbjct: 130 EEQKRMVSKSKALAF 144



 Score = 32.7 bits (71), Expect = 0.059
 Identities = 12/44 (27%), Positives = 21/44 (47%)
 Frame = +1

Query: 211 GCRSTSSSIPYEPRAIRFNVWDTAGQEKFGGLRDGYYIQGQCAI 342
           G    +  +  + + +   +WDTAGQE+F  L   +Y    C +
Sbjct: 42  GADFLTKEVLVDDKVVTLQLWDTAGQERFQSLGVAFYRGADCCV 85


>SPAC6F6.15 |ypt5||GTPase Ypt5|Schizosaccharomyces pombe|chr
           1|||Manual
          Length = 211

 Score = 45.6 bits (103), Expect = 8e-06
 Identities = 33/124 (26%), Positives = 59/124 (47%), Gaps = 5/124 (4%)
 Frame = +2

Query: 116 KCVLVGDGGTGKTTFVKRHLTGEFEKKYVATLG----VEVHPLVFHTNRGQFVLMCGTQP 283
           K VL+GD   GK++ V R +  +F+    +T+G     +  P+  +T+    +     Q 
Sbjct: 16  KLVLLGDSAVGKSSLVLRFVKDQFDDYRESTIGAAFLTQTLPIDENTSVKLEIWDTAGQE 75

Query: 284 DKRSLVVLETDTIFKDNVLSVMFDVTSRVTYKNVPNWHRDLVRVC-EGIPIVLCGNKVDI 460
             +SL  +        N   V++D+T   + +   +W ++L R   EGI I L GNK+D+
Sbjct: 76  RYKSLAPMYYRNA---NCAIVVYDITQAASLEKAKSWIKELQRQAPEGIVIALAGNKLDL 132

Query: 461 KDRK 472
              +
Sbjct: 133 AQER 136



 Score = 37.9 bits (84), Expect = 0.002
 Identities = 16/45 (35%), Positives = 25/45 (55%), Gaps = 1/45 (2%)
 Frame = +1

Query: 211 GCRSTSSSIPY-EPRAIRFNVWDTAGQEKFGGLRDGYYIQGQCAI 342
           G    + ++P  E  +++  +WDTAGQE++  L   YY    CAI
Sbjct: 48  GAAFLTQTLPIDENTSVKLEIWDTAGQERYKSLAPMYYRNANCAI 92


>SPAC16.01 |rho2||Rho family GTPase Rho2|Schizosaccharomyces
           pombe|chr 1|||Manual
          Length = 200

 Score = 43.6 bits (98), Expect = 3e-05
 Identities = 31/121 (25%), Positives = 53/121 (43%), Gaps = 1/121 (0%)
 Frame = +2

Query: 116 KCVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTNRGQFVLMCGTQPDKRS 295
           K V+VGDG  GKT+ +     G F  +YV T+  E +      +     L       +  
Sbjct: 10  KLVVVGDGACGKTSLLSVFTLGYFPTEYVPTV-FENYVSDCRVDGKSVQLALWDTAGQEE 68

Query: 296 LVVLETDTIFKDNVLSVMFDVTSRVTYKNV-PNWHRDLVRVCEGIPIVLCGNKVDIKDRK 472
              L   +  K +++ V F + S  + +NV   W  ++  +C  +P +L G K D++   
Sbjct: 69  YERLRPMSYAKAHIILVGFAIDSPDSLENVSTKWIEEINTLCPNVPFILVGMKADLRSDP 128

Query: 473 V 475
           V
Sbjct: 129 V 129


>SPAC17H9.09c |ras1|ste5|GTPase Ras1|Schizosaccharomyces pombe|chr
           1|||Manual
          Length = 219

 Score = 43.6 bits (98), Expect = 3e-05
 Identities = 28/126 (22%), Positives = 60/126 (47%), Gaps = 2/126 (1%)
 Frame = +2

Query: 113 FKCVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTNRGQFVLMCGTQPDKR 292
           +K V+VGDGG GK+    + +   F  +Y  T+             G  + +  T   + 
Sbjct: 9   YKLVVVGDGGVGKSALTIQLIQSHFVDEYDPTIEDSYRKKCEIDGEGALLDVLDTAGQEE 68

Query: 293 SLVVLETDTIFKDNVLSVMFDVTSRVTYKNVPNWHRDLVRV--CEGIPIVLCGNKVDIKD 466
              + E      +  L +++++TSR ++  +  +++ ++RV   +  P+VL  NK D++ 
Sbjct: 69  YSAMREQYMRTGEGFL-LVYNITSRSSFDEISTFYQQILRVKDKDTFPVVLVANKCDLEA 127

Query: 467 RKVKAK 484
            +V ++
Sbjct: 128 ERVVSR 133


>SPAC20H4.11c |rho5||Rho family GTPase Rho5|Schizosaccharomyces
           pombe|chr 1|||Manual
          Length = 200

 Score = 41.9 bits (94), Expect = 1e-04
 Identities = 31/118 (26%), Positives = 52/118 (44%), Gaps = 1/118 (0%)
 Frame = +2

Query: 116 KCVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTNRGQFVLMCGTQPDKRS 295
           K V+VGDG  GKT  +     G F + YV T+  E +      +     L       +  
Sbjct: 8   KLVIVGDGACGKTCLLIVFSKGTFPEVYVPTV-FENYVADVEVDGRHIELALWDTAGQED 66

Query: 296 LVVLETDTIFKDNVLSVMFDVTSRVTYKNV-PNWHRDLVRVCEGIPIVLCGNKVDIKD 466
              L   +    +V+ + F V +  +  NV   W  +++  C  +PI+L G KVD+++
Sbjct: 67  YDRLRPLSYPDSHVVLICFSVDAPESLDNVQEKWISEVLHFCSNLPILLVGCKVDLRN 124


>SPAC1565.06c |spg1|sid3|GTPase Spg1|Schizosaccharomyces pombe|chr
           1|||Manual
          Length = 198

 Score = 41.5 bits (93), Expect = 1e-04
 Identities = 27/117 (23%), Positives = 49/117 (41%), Gaps = 1/117 (0%)
 Frame = +2

Query: 110 TFKCVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTNRGQFVLMCGTQPDK 289
           T K  ++GD   GKT+ +  ++ G F+++   TLGV            +          +
Sbjct: 10  TIKVGMIGDSSIGKTSLMVTYVQGSFDEESTQTLGVNFMEKTISIRNTEITFSIWDLGGQ 69

Query: 290 RSLVVLETDTIFKDNV-LSVMFDVTSRVTYKNVPNWHRDLVRVCEGIPIVLCGNKVD 457
           R  V +    +  D V +  MFD++ + T  ++  W+R      +    +L G K D
Sbjct: 70  REFVNM-LPMVCNDAVAILFMFDLSRKSTLNSIKEWYRQARGFNKTAVPILIGTKYD 125


>SPAC23C4.08 |rho3||Rho family GTPase Rho3|Schizosaccharomyces
           pombe|chr 1|||Manual
          Length = 205

 Score = 40.3 bits (90), Expect = 3e-04
 Identities = 32/120 (26%), Positives = 56/120 (46%), Gaps = 4/120 (3%)
 Frame = +2

Query: 116 KCVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVE-VHPLVFHTNRGQFVL--MCGTQPD 286
           K V++GDG  GKT+ +     G F + Y  T+    +H +    N  +  L    G +  
Sbjct: 15  KIVILGDGAAGKTSLLNVFTKGYFPQVYEPTIFENYIHDIFVDGNSIELSLWDTAGQEEY 74

Query: 287 KRSLVVLETDTIFKDNVLSVMFDVTSRVTYKNV-PNWHRDLVRVCEGIPIVLCGNKVDIK 463
            +   +  +DT    +V+ + F V SR + +NV   W  ++   C G+ +VL   K D++
Sbjct: 75  DQLRSLSYSDT----HVIMICFAVDSRDSLENVITKWLPEVSSNCPGVKLVLVALKCDLR 130


>SPAPB1A10.10c |ypt71||GTPase Ypt71|Schizosaccharomyces pombe|chr
           1|||Manual
          Length = 208

 Score = 40.3 bits (90), Expect = 3e-04
 Identities = 26/129 (20%), Positives = 57/129 (44%), Gaps = 4/129 (3%)
 Frame = +2

Query: 116 KCVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTNRGQFVLMCGTQPDKRS 295
           K V++GD G GKT  + + +  +F ++Y AT+G +        +     L       +  
Sbjct: 10  KVVILGDSGVGKTCLMNQFVNQKFSREYKATIGADFLTKDVVVDDKLVTLQLWDTAGQER 69

Query: 296 LVVLETDTIFKDNVLSVMFDVTSRVTYKNVPNWHRDLVRVCE----GIPIVLCGNKVDIK 463
              L        +   ++++V +  ++ +V NW ++ +          P ++ GN++D K
Sbjct: 70  FQSLGMAFYRGADCCVIVYNVNNSKSFDSVENWRQEFLYQTSQDECAFPFIIVGNQID-K 128

Query: 464 DRKVKAKTI 490
           D   +A ++
Sbjct: 129 DASKRAVSL 137



 Score = 32.7 bits (71), Expect = 0.059
 Identities = 12/44 (27%), Positives = 21/44 (47%)
 Frame = +1

Query: 211 GCRSTSSSIPYEPRAIRFNVWDTAGQEKFGGLRDGYYIQGQCAI 342
           G    +  +  + + +   +WDTAGQE+F  L   +Y    C +
Sbjct: 42  GADFLTKDVVVDDKLVTLQLWDTAGQERFQSLGMAFYRGADCCV 85


>SPAC1F7.04 |rho1||Rho family GTPase Rho1|Schizosaccharomyces
           pombe|chr 1|||Manual
          Length = 202

 Score = 37.9 bits (84), Expect = 0.002
 Identities = 30/118 (25%), Positives = 50/118 (42%), Gaps = 1/118 (0%)
 Frame = +2

Query: 116 KCVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTNRGQFVLMCGTQPDKRS 295
           K V+VGDG  GKT  +     G F + YV T+  E +      +     L       +  
Sbjct: 8   KLVIVGDGACGKTCLLIVFSKGTFPEVYVPTV-FENYVADVEVDGRHVELALWDTAGQED 66

Query: 296 LVVLETDTIFKDNVLSVMFDVTSRVTYKNV-PNWHRDLVRVCEGIPIVLCGNKVDIKD 466
              L   +    +V+ + F V S  +  NV   W  +++  C  +PI+L   K D+++
Sbjct: 67  YDRLRPLSYPDSHVILICFAVDSPDSLDNVQEKWISEVLHFCSSLPILLVACKADLRN 124


>SPAC1B3.11c |ypt4||GTPase Ypt4|Schizosaccharomyces pombe|chr
           1|||Manual
          Length = 234

 Score = 37.9 bits (84), Expect = 0.002
 Identities = 17/50 (34%), Positives = 26/50 (52%)
 Frame = +1

Query: 172 FDWRVREKIRCDSGCRSTSSSIPYEPRAIRFNVWDTAGQEKFGGLRDGYY 321
           +D +V   +  D   R  S  +  + + I+  +WDTAGQEKF  +   YY
Sbjct: 34  WDDQVSHTVGIDFASRIISVGMGNQQKRIKLQIWDTAGQEKFRSVARNYY 83



 Score = 36.7 bits (81), Expect = 0.004
 Identities = 24/124 (19%), Positives = 59/124 (47%), Gaps = 5/124 (4%)
 Frame = +2

Query: 116 KCVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTNRG----QFVLMCGTQP 283
           K VL G  GTGK+  ++R +  +++ +   T+G++    +     G    +  L      
Sbjct: 11  KIVLAGPSGTGKSCLLQRFVKNQWDDQVSHTVGIDFASRIISVGMGNQQKRIKLQIWDTA 70

Query: 284 DKRSLVVLETDTIFKDNVLSVMFDVTSRVTYKNVPNWHRDLVRVCEG-IPIVLCGNKVDI 460
            +     +  +         +++DVT++ +++ + +W  D+  +    I +VL G+K D+
Sbjct: 71  GQEKFRSVARNYYRGAAGAVLVYDVTNKDSFEELSSWLSDIRAMAPSTICVVLAGSKSDL 130

Query: 461 KDRK 472
           ++++
Sbjct: 131 QNQR 134


>SPAC17C9.05c |pmc3|prk1, med27|mediator complex subunit Pmc3
           |Schizosaccharomyces pombe|chr 1|||Manual
          Length = 273

 Score = 31.1 bits (67), Expect = 0.18
 Identities = 16/59 (27%), Positives = 26/59 (44%)
 Frame = +2

Query: 173 LTGEFEKKYVATLGVEVHPLVFHTNRGQFVLMCGTQPDKRSLVVLETDTIFKDNVLSVM 349
           LT    K +   L  E+  + FH  RG+F + C +  D      +  +  F  N+ S+M
Sbjct: 155 LTTHENKSFTLKLANELEFIFFHDTRGKFSVYCSSSKDDAITFSINRNNNFLGNLWSLM 213


>SPCC320.04c |||GTPase Gem1 |Schizosaccharomyces pombe|chr
           3|||Manual
          Length = 630

 Score = 30.3 bits (65), Expect = 0.32
 Identities = 30/130 (23%), Positives = 54/130 (41%), Gaps = 1/130 (0%)
 Frame = +2

Query: 104 MPTFKCVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTNRGQFVLMCGTQP 283
           M   + V+ GD G GK++ +   +  +          +   P    +N    +++  TQ 
Sbjct: 1   MKEVRVVICGDQGVGKSSLISALIQEDNVTSIPKVFPIISIPSNPDSNDDVSLVLVDTQS 60

Query: 284 DKRSLVVLETDTIFKDNVLSVMFDVTSRVTYKNVPNWHRDLVR-VCEGIPIVLCGNKVDI 460
           D      L  + I K NV+ +++  +   +Y+ V  +     R +   +PIVLC NK + 
Sbjct: 61  DSNEREYLAAE-IKKANVICLVY--SDNYSYERVSIFWLPYFRSLGVNVPIVLCENKSED 117

Query: 461 KDRKVKAKTI 490
            D      TI
Sbjct: 118 LDNYQGLHTI 127


>SPBC119.15 |||AAA family ATPase, unknown biological
           role|Schizosaccharomyces pombe|chr 2|||Manual
          Length = 367

 Score = 29.1 bits (62), Expect = 0.73
 Identities = 15/45 (33%), Positives = 25/45 (55%), Gaps = 3/45 (6%)
 Frame = +2

Query: 122 VLVGDGGTGKTTFVKR---HLTGEFEKKYVATLGVEVHPLVFHTN 247
           ++VG  G+GKTTF+++   HL  + +  Y+  L   V  L +  N
Sbjct: 12  IVVGMAGSGKTTFMQQLNAHLHSKNKPPYILNLDPAVRNLPYEAN 56


>SPAC19D5.03 |cid1||poly|Schizosaccharomyces pombe|chr 1|||Manual
          Length = 405

 Score = 28.7 bits (61), Expect = 0.97
 Identities = 12/53 (22%), Positives = 26/53 (49%)
 Frame = +2

Query: 356 VTSRVTYKNVPNWHRDLVRVCEGIPIVLCGNKVDIKDRKVKAKTIVFHRKKIC 514
           ++   +Y+ VPN H++  + C  +      N++ I D++ K K       ++C
Sbjct: 28  ISKSCSYQKVPNSHKEFTKFCYEV-----YNEIKISDKEFKEKRAALDTLRLC 75


>SPBC1539.08 |||ADP-ribosylation factor, Arf
           family|Schizosaccharomyces pombe|chr 2|||Manual
          Length = 184

 Score = 28.3 bits (60), Expect = 1.3
 Identities = 11/22 (50%), Positives = 14/22 (63%)
 Frame = +1

Query: 256 IRFNVWDTAGQEKFGGLRDGYY 321
           I+FNVWD  GQ+K   L   Y+
Sbjct: 65  IKFNVWDVGGQDKIRPLWRHYF 86


>SPBC14F5.06 |||iron-sulfur protein|Schizosaccharomyces pombe|chr
           2|||Manual
          Length = 593

 Score = 27.9 bits (59), Expect = 1.7
 Identities = 11/15 (73%), Positives = 13/15 (86%)
 Frame = +2

Query: 122 VLVGDGGTGKTTFVK 166
           VL+G+ GTGKTTF K
Sbjct: 379 VLLGENGTGKTTFCK 393


>SPBC4F6.18c |arf1||ADP-ribosylation factor Arf1|Schizosaccharomyces
           pombe|chr 2|||Manual
          Length = 180

 Score = 27.5 bits (58), Expect = 2.2
 Identities = 16/39 (41%), Positives = 18/39 (46%)
 Frame = +1

Query: 244 EPRAIRFNVWDTAGQEKFGGLRDGYYIQGQCAISHVRRN 360
           E R I F VWD  GQ+K   L   Y+   Q  I  V  N
Sbjct: 57  EYRNISFTVWDVGGQDKIRPLWRHYFQNTQGIIFVVDSN 95


>SPAC24H6.13 |||DUF221 family protein|Schizosaccharomyces pombe|chr
           1|||Manual
          Length = 871

 Score = 27.5 bits (58), Expect = 2.2
 Identities = 22/77 (28%), Positives = 34/77 (44%)
 Frame = -1

Query: 294 LLLSGCVPHIKTNCPRFVWNTRGCTSTPRVATYFFSNSPVKCLLTKVVLPVPPSPTNTHL 115
           LLLS  +  I  N PR  WN     S P   T +    PV  LL  +++          +
Sbjct: 538 LLLSKVLGRIFDNTPRKKWNRWNQLSAPSWGTVY----PVYSLLVTIMICY---SIIAPI 590

Query: 114 NVGISSAIFVVLWLFYS 64
            +G ++  FV+++  YS
Sbjct: 591 IIGFAAVAFVLIYFAYS 607


>SPAC26F1.08c |||conserved protein|Schizosaccharomyces pombe|chr
            1|||Manual
          Length = 977

 Score = 26.2 bits (55), Expect = 5.2
 Identities = 17/55 (30%), Positives = 28/55 (50%), Gaps = 5/55 (9%)
 Frame = -1

Query: 378  LYVTREVTSNMTDSTLSLNIVSVSKTTKLLLSGC-----VPHIKTNCPRFVWNTR 229
            LY+  +V  NM D    L IVS++ T  +L +       +P+   +C + +WN R
Sbjct: 839  LYLYYDVVKNMIDYRKDL-IVSMTLTFYILYNSIMSKAPIPYFVPSCRQALWNLR 892


>SPCC737.08 |||midasin |Schizosaccharomyces pombe|chr 3|||Manual
          Length = 4717

 Score = 25.4 bits (53), Expect = 9.0
 Identities = 9/16 (56%), Positives = 12/16 (75%)
 Frame = +2

Query: 119  CVLVGDGGTGKTTFVK 166
            C+LVGD  TGKT  ++
Sbjct: 1872 CILVGDTATGKTCILR 1887


>SPAC17A5.14 |exo2||exonuclease II Exo2 |Schizosaccharomyces
           pombe|chr 1|||Manual
          Length = 1328

 Score = 25.4 bits (53), Expect = 9.0
 Identities = 12/20 (60%), Positives = 14/20 (70%)
 Frame = +2

Query: 626 FCHQKLQWDPQWQNPIEKIF 685
           F H+K+  D QWQN IE IF
Sbjct: 149 FIHKKVTNDSQWQN-IEVIF 167


>SPAC1A6.11 |||dubious|Schizosaccharomyces pombe|chr 1|||Manual
          Length = 106

 Score = 25.4 bits (53), Expect = 9.0
 Identities = 11/33 (33%), Positives = 19/33 (57%)
 Frame = -1

Query: 516 LQIFFLWKTIVFALTFLSLISTLFPHKTIGIPS 418
           L  F LW   V+ ++ +SL ++ FPH  + + S
Sbjct: 8   LTSFNLWSHGVYKISSISLSNSFFPHSFMFVKS 40


>SPBC530.08 |||transcription factor |Schizosaccharomyces pombe|chr
           2|||Manual
          Length = 815

 Score = 25.4 bits (53), Expect = 9.0
 Identities = 24/78 (30%), Positives = 40/78 (51%), Gaps = 5/78 (6%)
 Frame = -1

Query: 471 FLSLISTLFPHKTIGIPSHTRTKSLCQLGTFLYVTREVTS--NMT-DSTLSLNIVSVSKT 301
           FLS++   + H  +  PS+T  +SL +  +F Y  R V S  N T +S   L I+S+ + 
Sbjct: 269 FLSILCVGYYHHLLNNPSNTELQSLIKKYSF-YSERLVKSADNFTIESIQCLLILSIYRY 327

Query: 300 TKLLLSGCVPHIK--TNC 253
            +  +S    ++K   NC
Sbjct: 328 CRTEISAAWYYMKLGLNC 345


>SPAC29B12.01 |ino80|SPAC3G6.12|SNF2 family helicase
            Ino80|Schizosaccharomyces pombe|chr 1|||Manual
          Length = 1604

 Score = 25.4 bits (53), Expect = 9.0
 Identities = 14/35 (40%), Positives = 20/35 (57%)
 Frame = -2

Query: 650  PIVTSGGRRAGMATNSRLPSPINFLASHRKGFSKL 546
            P++ S G   G  +N R+PS + F+A   K  SKL
Sbjct: 1401 PLLPSFGIAKGSYSNVRIPSMLRFIADSGK-LSKL 1434


  Database: spombe
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 2,362,478
  Number of sequences in database:  5004
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 3,506,235
Number of Sequences: 5004
Number of extensions: 77598
Number of successful extensions: 325
Number of sequences better than 10.0: 31
Number of HSP's better than 10.0 without gapping: 278
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 307
length of database: 2,362,478
effective HSP length: 71
effective length of database: 2,007,194
effective search space used: 369323696
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -