SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS20002
         (732 letters)

Database: spombe 
           5004 sequences; 2,362,478 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SPAC1A6.05c |||triacylglycerol lipase|Schizosaccharomyces pombe|...    26   4.8  
SPBC2D10.14c |myo51||myosin type V|Schizosaccharomyces pombe|chr...    26   6.4  
SPCC4G3.09c |gyp3||GTPase activating protein Gyp3|Schizosaccharo...    26   6.4  

>SPAC1A6.05c |||triacylglycerol lipase|Schizosaccharomyces pombe|chr
           1|||Manual
          Length = 483

 Score = 26.2 bits (55), Expect = 4.8
 Identities = 11/25 (44%), Positives = 16/25 (64%), Gaps = 2/25 (8%)
 Frame = +2

Query: 662 HTKLIARF--NHFLLSSIHFHLYIF 730
           H KL   F  NHF++S ++FH+  F
Sbjct: 336 HAKLTELFHVNHFIVSQVNFHIVPF 360


>SPBC2D10.14c |myo51||myosin type V|Schizosaccharomyces pombe|chr
            2|||Manual
          Length = 1471

 Score = 25.8 bits (54), Expect = 6.4
 Identities = 28/92 (30%), Positives = 43/92 (46%), Gaps = 7/92 (7%)
 Frame = +3

Query: 3    ARAHSYNDHCRCLTIVKCSVTVVSIV----SYLR*V--YQSG*HALCF*YA*AYDNRLQH 164
            A   SY    R L+++KC++ + SIV    +Y R +   +     L   +  AY+ R   
Sbjct: 809  AHWRSYIQRKRYLSLIKCAIVIQSIVRKNIAYSRYINELRESSATLLAKFWRAYNARKTF 868

Query: 165  PRYKKNSIPL-CRTNTNTTLKILRRHCTSARR 257
               KK+ I L C + +  T + LRR   SA R
Sbjct: 869  RGLKKSVIALQCVSRSVLTRRYLRRLQDSAGR 900


>SPCC4G3.09c |gyp3||GTPase activating protein
           Gyp3|Schizosaccharomyces pombe|chr 3|||Manual
          Length = 635

 Score = 25.8 bits (54), Expect = 6.4
 Identities = 11/35 (31%), Positives = 19/35 (54%)
 Frame = -2

Query: 329 DRHESTVRKKHSVPPNDFAFSVTDSSRRSTMSSQD 225
           + +ES  R    +PP DF  + T+ S+R +  S +
Sbjct: 132 NEYESKFRLSLEIPPTDFLSTSTELSKRESCLSTE 166


  Database: spombe
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 2,362,478
  Number of sequences in database:  5004
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 2,801,300
Number of Sequences: 5004
Number of extensions: 55628
Number of successful extensions: 158
Number of sequences better than 10.0: 3
Number of HSP's better than 10.0 without gapping: 152
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 158
length of database: 2,362,478
effective HSP length: 71
effective length of database: 2,007,194
effective search space used: 345237368
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -