SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS20001
         (745 letters)

Database: spombe 
           5004 sequences; 2,362,478 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SPCC1739.13 |ssa2||heat shock protein Ssa2|Schizosaccharomyces p...   178   6e-46
SPAC13G7.02c |ssa1||heat shock protein Ssa1|Schizosaccharomyces ...   176   2e-45
SPAC22A12.15c |bip1|bip|BiP |Schizosaccharomyces pombe|chr 1|||M...   161   1e-40
SPAC664.11 |ssc1|ssp1|Hsp70 chaperone mtHsp70|Schizosaccharomyce...   122   4e-29
SPBC1709.05 |sks2|hsc1|heat shock protein Sks2|Schizosaccharomyc...   102   5e-23
SPAC110.04c |pss1|ssp1, SPAP14E8.01c|heat shock protein Pss1|Sch...    70   4e-13
SPAC57A7.12 |||heat shock protein Pdr13 |Schizosaccharomyces pom...    40   5e-04
SPAC1F5.06 |||heat shock protein Lhs1 |Schizosaccharomyces pombe...    31   0.23 
SPAC25B8.04c |||mitochondrial splicing suppressor |Schizosacchar...    29   0.92 
SPAC823.11 |||sphingosine-1-phosphate phosphatase |Schizosacchar...    27   2.8  
SPCC550.03c |||RNA helicase involved in mRNA catabolism|Schizosa...    27   3.7  
SPAC22G7.06c |ura1||carbamoyl-phosphate synthase |Schizosaccharo...    26   4.9  
SPBPJ4664.02 |||glycoprotein |Schizosaccharomyces pombe|chr 2|||...    26   6.5  
SPAC1F7.01c |spt6|SPAC694.07c|transcription elongation factor Sp...    25   8.6  
SPAPJ760.02c |app1||App1 protein|Schizosaccharomyces pombe|chr 1...    25   8.6  

>SPCC1739.13 |ssa2||heat shock protein Ssa2|Schizosaccharomyces
           pombe|chr 3|||Manual
          Length = 647

 Score =  178 bits (434), Expect = 6e-46
 Identities = 110/206 (53%), Positives = 124/206 (60%), Gaps = 12/206 (5%)
 Frame = +3

Query: 87  AVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMTPTT 266
           ++GIDLGTTYSCVG F + +VEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAM P  
Sbjct: 4   SIGIDLGTTYSCVGHFSNNRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPHN 63

Query: 267 -----------QYSMPNVSSDVSSKMLLCKPT*STGLSRLSVMEANLRSR*HIRVKTKPF 413
                      ++  P V SD+  K    K     G   L V           + +TK F
Sbjct: 64  TIFDAKRLIGRKFDDPEVQSDM--KHWPFKVISKDGKPVLQV---------EYKGETKTF 112

Query: 414 SPRKSVPWCXXXXXXXXXXIL-ANCAECSYHGSAYFNDSQRQATKDAGTISGLNVLRIIN 590
           +P +                L     +      AYFNDSQRQATKDAG I+GLNVLRIIN
Sbjct: 113 TPEEISSMVLMKMRETAEAYLGGKVTDAVVTVPAYFNDSQRQATKDAGLIAGLNVLRIIN 172

Query: 591 EPTAAAIAYGLDKKGTGERNVLIFDL 668
           EPTAAAIAYGLD+   GE NVLIFDL
Sbjct: 173 EPTAAAIAYGLDRSNQGESNVLIFDL 198



 Score =  146 bits (353), Expect = 4e-36
 Identities = 86/167 (51%), Positives = 105/167 (62%), Gaps = 3/167 (1%)
 Frame = +2

Query: 254 DPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVSDGGKPKIKVAYKGEDKTFFPEEVSS 433
           +P+NTIFDAKRLIGRKF+D  VQ+DMKHWPF+V+S  GKP ++V YKGE KTF PEE+SS
Sbjct: 60  NPHNTIFDAKRLIGRKFDDPEVQSDMKHWPFKVISKDGKPVLQVEYKGETKTFTPEEISS 119

Query: 434 MVLTKMKETAEAYL-GKLCRMQLSRFRVLQ*LSKTSHKRCRYHLWLE--RSPNHQ*TDCC 604
           MVL KM+ETAEAYL GK+    ++         + + K       L   R  N       
Sbjct: 120 MVLMKMRETAEAYLGGKVTDAVVTVPAYFNDSQRQATKDAGLIAGLNVLRIINEPTAAAI 179

Query: 605 CDCLRS*QKGYWRTKCTYL*PRGGTFDVSILTIEDGIFEVKSTAGDT 745
              L    +G        L   GGTFDVS+LTIE+GIFEVK+TAGDT
Sbjct: 180 AYGLDRSNQGESNVLIFDL--GGGTFDVSLLTIEEGIFEVKATAGDT 224


>SPAC13G7.02c |ssa1||heat shock protein Ssa1|Schizosaccharomyces
           pombe|chr 1|||Manual
          Length = 644

 Score =  176 bits (429), Expect = 2e-45
 Identities = 104/199 (52%), Positives = 124/199 (62%), Gaps = 5/199 (2%)
 Frame = +3

Query: 87  AVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMTPTT 266
           ++GIDLGTTYSCVG F + +VEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAM P  
Sbjct: 4   SIGIDLGTTYSCVGHFSNNRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNP-- 61

Query: 267 QYSMPNVSSDVSSKMLLCKPT*STGLSR--LSVMEANLRSR*HIRVK--TKPFSPRKSVP 434
             ++ +    +  +     P   + +      V+E + +    +  K  TK F+P +   
Sbjct: 62  HNTIFDAKRLIGRR--FNDPEVQSDMKHWPFKVIEKDGKPLIQVEFKGETKTFTPEEISS 119

Query: 435 WCXXXXXXXXXXIL-ANCAECSYHGSAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAI 611
                        L     +      AYFNDSQRQATKDAG I+GLNVLRIINEPTAAAI
Sbjct: 120 MVLLKMRESAEAFLGGKVTDAVVTVPAYFNDSQRQATKDAGLIAGLNVLRIINEPTAAAI 179

Query: 612 AYGLDKKGTGERNVLIFDL 668
           AYGLD+    E NVLIFDL
Sbjct: 180 AYGLDRSNQHETNVLIFDL 198



 Score =  138 bits (335), Expect = 6e-34
 Identities = 78/165 (47%), Positives = 99/165 (60%), Gaps = 1/165 (0%)
 Frame = +2

Query: 254 DPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVSDGGKPKIKVAYKGEDKTFFPEEVSS 433
           +P+NTIFDAKRLIGR+F D  VQ+DMKHWPF+V+   GKP I+V +KGE KTF PEE+SS
Sbjct: 60  NPHNTIFDAKRLIGRRFNDPEVQSDMKHWPFKVIEKDGKPLIQVEFKGETKTFTPEEISS 119

Query: 434 MVLTKMKETAEAYL-GKLCRMQLSRFRVLQ*LSKTSHKRCRYHLWLERSPNHQ*TDCCCD 610
           MVL KM+E+AEA+L GK+    ++         + + K       L              
Sbjct: 120 MVLLKMRESAEAFLGGKVTDAVVTVPAYFNDSQRQATKDAGLIAGLNVLRIINEPTAAAI 179

Query: 611 CLRS*QKGYWRTKCTYL*PRGGTFDVSILTIEDGIFEVKSTAGDT 745
                +     T        GGTFDVS+LTIE+GIFEVK+TAGDT
Sbjct: 180 AYGLDRSNQHETNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDT 224


>SPAC22A12.15c |bip1|bip|BiP |Schizosaccharomyces pombe|chr
           1|||Manual
          Length = 663

 Score =  161 bits (390), Expect = 1e-40
 Identities = 91/195 (46%), Positives = 119/195 (61%), Gaps = 2/195 (1%)
 Frame = +3

Query: 90  VGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMTP-TT 266
           +GIDLGTTYSCV V ++G+VEIIANDQGNR TPSYVAFT+ ERL+G+AAKNQ    P  T
Sbjct: 38  IGIDLGTTYSCVAVMKNGRVEIIANDQGNRITPSYVAFTEDERLVGEAAKNQAPSNPENT 97

Query: 267 QYSMPNVSSDVSSKMLLCKPT*STGLSRLSVMEANLRSR*HIRVKTKPFSPRKSVPWCXX 446
            + +  +      +  + K   S     ++     L    ++  K K F+P +       
Sbjct: 98  IFDIKRLIGRKFDEKTMAKDIKSFPFHIVNDKNRPL-VEVNVGGKKKKFTPEEISAMILS 156

Query: 447 XXXXXXXXILAN-CAECSYHGSAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGL 623
                    L            AYFND+QRQATKDAGTI+GLNV+RI+NEPTAAAIAYGL
Sbjct: 157 KMKQTAEAYLGKPVTHAVVTVPAYFNDAQRQATKDAGTIAGLNVIRIVNEPTAAAIAYGL 216

Query: 624 DKKGTGERNVLIFDL 668
           DK  T E++++++DL
Sbjct: 217 DKTDT-EKHIVVYDL 230



 Score = 99.5 bits (237), Expect = 4e-22
 Identities = 43/76 (56%), Positives = 60/76 (78%)
 Frame = +2

Query: 254 DPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVSDGGKPKIKVAYKGEDKTFFPEEVSS 433
           +P NTIFD KRLIGRKF++ T+  D+K +PF +V+D  +P ++V   G+ K F PEE+S+
Sbjct: 93  NPENTIFDIKRLIGRKFDEKTMAKDIKSFPFHIVNDKNRPLVEVNVGGKKKKFTPEEISA 152

Query: 434 MVLTKMKETAEAYLGK 481
           M+L+KMK+TAEAYLGK
Sbjct: 153 MILSKMKQTAEAYLGK 168



 Score = 43.2 bits (97), Expect = 4e-05
 Identities = 17/25 (68%), Positives = 24/25 (96%)
 Frame = +2

Query: 671 GGTFDVSILTIEDGIFEVKSTAGDT 745
           GGTFDVS+L+I++G+FEV +T+GDT
Sbjct: 232 GGTFDVSLLSIDNGVFEVLATSGDT 256


>SPAC664.11 |ssc1|ssp1|Hsp70 chaperone mtHsp70|Schizosaccharomyces
           pombe|chr 1|||Manual
          Length = 674

 Score =  122 bits (295), Expect = 4e-29
 Identities = 81/205 (39%), Positives = 111/205 (54%), Gaps = 8/205 (3%)
 Frame = +3

Query: 78  KAPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFT-DTERLIGDAAKNQVAM 254
           K P +GIDLGTT SC+ + +    ++IAN +G RTTPS VAFT D ERL+G +AK Q  +
Sbjct: 49  KGPVIGIDLGTTTSCLAIMEGQTPKVIANAEGTRTTPSVVAFTKDGERLVGVSAKRQAVI 108

Query: 255 TPTTQYSMPNVSSDVSSKMLLCKPT*STGLSRLSVMEANLRSR*H------IRVKTKPFS 416
            P   +         ++K L+ +      + R  + E   +   H      +  + K +S
Sbjct: 109 NPENTF--------FATKRLIGRRFKEPEVQR-DIKEVPYKIVEHSNGDAWLEARGKTYS 159

Query: 417 PRKSVPWCXXXXXXXXXXILA-NCAECSYHGSAYFNDSQRQATKDAGTISGLNVLRIINE 593
           P +   +            L  +         AYFNDSQRQATK AG I+GLNVLR++NE
Sbjct: 160 PSQIGGFILSKMRETASTYLGKDVKNAVVTVPAYFNDSQRQATKAAGAIAGLNVLRVVNE 219

Query: 594 PTAAAIAYGLDKKGTGERNVLIFDL 668
           PTAAA+AYGLDKK   +  V +FDL
Sbjct: 220 PTAAALAYGLDKK--NDAIVAVFDL 242



 Score = 65.3 bits (152), Expect = 9e-12
 Identities = 30/76 (39%), Positives = 45/76 (59%)
 Frame = +2

Query: 254 DPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVSDGGKPKIKVAYKGEDKTFFPEEVSS 433
           +P NT F  KRLIGR+F++  VQ D+K  P+++V            +   KT+ P ++  
Sbjct: 109 NPENTFFATKRLIGRRFKEPEVQRDIKEVPYKIVEHSNG---DAWLEARGKTYSPSQIGG 165

Query: 434 MVLTKMKETAEAYLGK 481
            +L+KM+ETA  YLGK
Sbjct: 166 FILSKMRETASTYLGK 181



 Score = 42.7 bits (96), Expect = 5e-05
 Identities = 17/25 (68%), Positives = 22/25 (88%)
 Frame = +2

Query: 671 GGTFDVSILTIEDGIFEVKSTAGDT 745
           GGTFD+SIL + +G+FEV+ST GDT
Sbjct: 244 GGTFDISILELNNGVFEVRSTNGDT 268


>SPBC1709.05 |sks2|hsc1|heat shock protein Sks2|Schizosaccharomyces
           pombe|chr 2|||Manual
          Length = 613

 Score =  102 bits (245), Expect = 5e-23
 Identities = 45/76 (59%), Positives = 58/76 (76%)
 Frame = +2

Query: 254 DPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVSDGGKPKIKVAYKGEDKTFFPEEVSS 433
           +P NT+FDAKRLIGR++ED   Q D+KHWPF+V+ + G P I+V Y GE K F  +E+S+
Sbjct: 64  NPRNTVFDAKRLIGRRYEDPETQKDIKHWPFKVIDNNGIPTIEVNYLGEKKQFTAQEISA 123

Query: 434 MVLTKMKETAEAYLGK 481
           MVLTKMKE +EA L K
Sbjct: 124 MVLTKMKEISEAKLNK 139



 Score = 97.9 bits (233), Expect = 1e-21
 Identities = 44/58 (75%), Positives = 50/58 (86%)
 Frame = +3

Query: 87  AVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMTP 260
           A+GIDLGTTYSCV V++   VEII NDQG RTTPS+VAFT+TERL+GDAAKNQ AM P
Sbjct: 8   AIGIDLGTTYSCVAVWETANVEIIPNDQGARTTPSFVAFTETERLVGDAAKNQAAMNP 65



 Score = 89.0 bits (211), Expect = 6e-19
 Identities = 43/53 (81%), Positives = 46/53 (86%)
 Frame = +3

Query: 510 AYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDL 668
           AYF+DSQR ATKDAG I+GLNVLRIINEPTAAAIAYGLD K    +NVLIFDL
Sbjct: 150 AYFSDSQRAATKDAGAIAGLNVLRIINEPTAAAIAYGLDAKSDKPKNVLIFDL 202



 Score = 42.7 bits (96), Expect = 5e-05
 Identities = 18/25 (72%), Positives = 22/25 (88%)
 Frame = +2

Query: 671 GGTFDVSILTIEDGIFEVKSTAGDT 745
           GGTFDVS+L I+ G+FEV +TAGDT
Sbjct: 204 GGTFDVSLLKIQGGVFEVLATAGDT 228


>SPAC110.04c |pss1|ssp1, SPAP14E8.01c|heat shock protein
           Pss1|Schizosaccharomyces pombe|chr 1|||Manual
          Length = 720

 Score = 69.7 bits (163), Expect = 4e-13
 Identities = 52/197 (26%), Positives = 94/197 (47%), Gaps = 12/197 (6%)
 Frame = +3

Query: 75  AKAPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAM 254
           ++   VGID G + + + V ++  +++I N+  NR+TPS V++ +  R +G+AAK+  A 
Sbjct: 3   SRTNVVGIDFGNSKTVIAVARNRAIDVIVNEVSNRSTPSLVSYGERSRFLGEAAKSAEAS 62

Query: 255 T-----------PTTQYSMPNVSSDVSSKMLLCKPT*STGLSRLSVMEANLRSR-*HIRV 398
                           Y  P +  D+ S  +  K T   G     V   N  +   +I++
Sbjct: 63  NFRNTVGSLKRLAGRTYDDPEI-KDIESNFISAKLTEVDGFVGAKVQYLNEETAFSNIQL 121

Query: 399 KTKPFSPRKSVPWCXXXXXXXXXXILANCAECSYHGSAYFNDSQRQATKDAGTISGLNVL 578
               F+  K++             ++ + ++      A+F D QR+A  +A  I+GLN L
Sbjct: 122 IAAYFTKIKAI---------AEAELIGSVSDVVISIPAWFTDIQRRALLEAANIAGLNPL 172

Query: 579 RIINEPTAAAIAYGLDK 629
           R++N+  AAA+ YG+ K
Sbjct: 173 RLMNDNAAAALTYGITK 189



 Score = 32.7 bits (71), Expect = 0.057
 Identities = 21/72 (29%), Positives = 34/72 (47%), Gaps = 1/72 (1%)
 Frame = +2

Query: 263 NTIFDAKRLIGRKFEDATVQ-ADMKHWPFEVVSDGGKPKIKVAYKGEDKTFFPEEVSSMV 439
           NT+   KRL GR ++D  ++  +      ++    G    KV Y  E+  F   ++ +  
Sbjct: 66  NTVGSLKRLAGRTYDDPEIKDIESNFISAKLTEVDGFVGAKVQYLNEETAFSNIQLIAAY 125

Query: 440 LTKMKETAEAYL 475
            TK+K  AEA L
Sbjct: 126 FTKIKAIAEAEL 137


>SPAC57A7.12 |||heat shock protein Pdr13 |Schizosaccharomyces
           pombe|chr 1|||Manual
          Length = 566

 Score = 39.5 bits (88), Expect = 5e-04
 Identities = 16/53 (30%), Positives = 30/53 (56%)
 Frame = +3

Query: 90  VGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQV 248
           +GI  G   S +   + GK +++AN++GNR  PS +++   +   G  A+ Q+
Sbjct: 27  IGISFGNQNSSIAFNRDGKTDVLANEEGNRQIPSILSYHGDQEYHGVQARGQL 79



 Score = 38.7 bits (86), Expect = 9e-04
 Identities = 19/64 (29%), Positives = 35/64 (54%)
 Frame = +3

Query: 492 CSYHGSAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLA 671
           C      YF D+QR+A + A   +GL VL++I++P A  +A    ++   ++ V++ +  
Sbjct: 166 CVMSVPVYFTDAQRKALESAANEAGLPVLQLIHDPAAVILALMYSEEVLIDKTVVVANFG 225

Query: 672 AVPS 683
           A  S
Sbjct: 226 ATRS 229


>SPAC1F5.06 |||heat shock protein Lhs1 |Schizosaccharomyces
           pombe|chr 1|||Manual
          Length = 848

 Score = 30.7 bits (66), Expect = 0.23
 Identities = 21/67 (31%), Positives = 31/67 (46%), Gaps = 1/67 (1%)
 Frame = +3

Query: 90  VGIDLGTTYSCVGVFQHG-KVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMTPTT 266
           + ID GT ++   + + G  +EI+      R   S VAF   ER+ G  A N     P  
Sbjct: 25  LAIDYGTEWTKAALIKPGIPLEIVLTKDTRRKEQSAVAFKGNERIFGVDASNLATRFPA- 83

Query: 267 QYSMPNV 287
            +S+ NV
Sbjct: 84  -HSIRNV 89


>SPAC25B8.04c |||mitochondrial splicing suppressor
           |Schizosaccharomyces pombe|chr 1|||Manual
          Length = 378

 Score = 28.7 bits (61), Expect = 0.92
 Identities = 12/32 (37%), Positives = 18/32 (56%)
 Frame = +1

Query: 82  HPQ*ESIWVPRTLALVSSSTGRWRSSPTTRAT 177
           HP   S W+P    LVS+    W +SP+++ T
Sbjct: 283 HPLYSSSWIPTLHDLVSTRCSVWLTSPSSQRT 314


>SPAC823.11 |||sphingosine-1-phosphate phosphatase
           |Schizosaccharomyces pombe|chr 1|||Manual
          Length = 411

 Score = 27.1 bits (57), Expect = 2.8
 Identities = 17/55 (30%), Positives = 27/55 (49%)
 Frame = -2

Query: 168 GRWR*SPPSRAGRHQRKSTWYPDRFLLRVLLPFCIFNQSCYLFLKQLSKRARLLV 4
           G W  SP S +  H   ++++  +F +RVL   C+      L  K  +K+A L V
Sbjct: 276 GTWFASPESLSHLHDNLNSYFLLKFFVRVLFGVCMI-----LIWKSFAKQALLAV 325


>SPCC550.03c |||RNA helicase involved in mRNA
           catabolism|Schizosaccharomyces pombe|chr 3|||Manual
          Length = 1213

 Score = 26.6 bits (56), Expect = 3.7
 Identities = 12/28 (42%), Positives = 15/28 (53%)
 Frame = -1

Query: 703 DGKDGHVEGTAARSKISTFRSPVPFLSR 620
           D  DGH+  T A   + TF  P P LS+
Sbjct: 28  DSFDGHLSITEATYDVDTFLKPSPALSK 55


>SPAC22G7.06c |ura1||carbamoyl-phosphate synthase |Schizosaccharomyces
            pombe|chr 1|||Manual
          Length = 2244

 Score = 26.2 bits (55), Expect = 4.9
 Identities = 14/45 (31%), Positives = 24/45 (53%)
 Frame = +3

Query: 186  PSYVAFTDTERLIGDAAKNQVAMTPTTQYSMPNVSSDVSSKMLLC 320
            P  +A T  ER++  AAK   A+  T  Y++  ++ D   K++ C
Sbjct: 1252 PQDLAPTTIERIVDAAAKIGEALNITGPYNIQFIAKDNEIKVIEC 1296


>SPBPJ4664.02 |||glycoprotein |Schizosaccharomyces pombe|chr
            2|||Manual
          Length = 3971

 Score = 25.8 bits (54), Expect = 6.5
 Identities = 20/70 (28%), Positives = 35/70 (50%)
 Frame = -2

Query: 456  SFIFVSTMELTSSGKKVLSSPLYATLILGLPPSLTTSKGQCFMSACTVASSNLRPMRRLA 277
            S +  S+  +TSS     S+P+ ++ +L     +T+S G    +  T +SS L     + 
Sbjct: 903  STVVNSSTPITSSTALNTSTPITSSSVLNSSTPITSSTGLNTSTPIT-SSSVLNSSTPIT 961

Query: 276  SNIVLLGSSP 247
            S+ VL  S+P
Sbjct: 962  SSTVLNSSTP 971


>SPAC1F7.01c |spt6|SPAC694.07c|transcription elongation factor
            Spt6|Schizosaccharomyces pombe|chr 1|||Manual
          Length = 1365

 Score = 25.4 bits (53), Expect = 8.6
 Identities = 11/44 (25%), Positives = 23/44 (52%)
 Frame = -2

Query: 357  LTTSKGQCFMSACTVASSNLRPMRRLASNIVLLGSSPPGSWRHL 226
            L  S+ + ++S   V    +RP  + + +IV+      GS++H+
Sbjct: 1173 LNASQAEAYLSKMQVGDLVIRPSSKGSDHIVVTWKVAEGSYQHI 1216


>SPAPJ760.02c |app1||App1 protein|Schizosaccharomyces pombe|chr
           1|||Manual
          Length = 857

 Score = 25.4 bits (53), Expect = 8.6
 Identities = 12/34 (35%), Positives = 17/34 (50%)
 Frame = +3

Query: 198 AFTDTERLIGDAAKNQVAMTPTTQYSMPNVSSDV 299
           AF D  +  G  AK   A  P+T+  + N+S  V
Sbjct: 155 AFYDASQTFGSTAKVAPAPAPSTKTPLANISKPV 188


  Database: spombe
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 2,362,478
  Number of sequences in database:  5004
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 3,301,741
Number of Sequences: 5004
Number of extensions: 71365
Number of successful extensions: 245
Number of sequences better than 10.0: 15
Number of HSP's better than 10.0 without gapping: 218
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 244
length of database: 2,362,478
effective HSP length: 71
effective length of database: 2,007,194
effective search space used: 353266144
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -