SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= psV30166.Seq
         (892 letters)

Database: spombe 
           5004 sequences; 2,362,478 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SPAC1F5.02 |||protein disulfide isomerase|Schizosaccharomyces po...    62   8e-11
SPAC13F5.05 |||thioredoxin family protein|Schizosaccharomyces po...    51   3e-07
SPAC17H9.14c |||protein disulfide isomerase|Schizosaccharomyces ...    49   1e-06
SPAC7D4.07c |trx1||cytosolic thioredoxin Trx1 |Schizosaccharomyc...    41   2e-04
SPBC577.08c |txl1|trx3|thioredoxin-like I protein Txl1|Schizosac...    40   6e-04
SPAC959.05c |||protein disulfide isomerase |Schizosaccharomyces ...    36   0.006
SPBC12D12.07c |trx2||mitochondrial thioredoxin Trx2|Schizosaccha...    36   0.006
SPBC3D6.13c |||protein disulfide isomerase |Schizosaccharomyces ...    31   0.29 
SPBC26H8.06 |grx4||glutaredoxin Grx4|Schizosaccharomyces pombe|c...    28   2.1  
SPAC589.02c |med13|spTrap240, srb9|mediator complex subunit Srb9...    27   2.7  
SPAC1142.01 ||SPAC17G6.18|DUF654 family protein|Schizosaccharomy...    27   2.7  
SPCC18.03 |||shuttle craft like transcriptional regulator|Schizo...    26   8.3  

>SPAC1F5.02 |||protein disulfide isomerase|Schizosaccharomyces
           pombe|chr 1|||Manual
          Length = 492

 Score = 62.5 bits (145), Expect = 8e-11
 Identities = 32/84 (38%), Positives = 50/84 (59%), Gaps = 2/84 (2%)
 Frame = +1

Query: 262 IKLAKVDATQEQDLAESYGVRGYPTLKFFRNGSPI-DYSGGRQADDIISWLKKKTGPPAV 438
           I L +VD T+E DL   Y +RGYPTL  F+NG  I  YSG R+ D ++ +++K+   P V
Sbjct: 73  ISLVEVDCTEEGDLCSEYSIRGYPTLNVFKNGKQISQYSGPRKHDALVKYMRKQL-LPTV 131

Query: 439 EVTSAEQAKELID-ANTVIVFGFF 507
           +  S +  +  ++ A+ + V  FF
Sbjct: 132 KPISKDTLENFVEKADDLAVVAFF 155



 Score = 62.1 bits (144), Expect = 1e-10
 Identities = 25/53 (47%), Positives = 40/53 (75%), Gaps = 1/53 (1%)
 Frame = +2

Query: 98  TEENVLVLSKANFETVITT-TEYILVEFYAPWCGHCKSLAPEYAKAATKLAEE 253
           ++E+++VL   NF+ ++   T+ +LVEFYAPWCGHCK+LAP Y K A + +++
Sbjct: 353 SQEDLVVLVADNFDDIVMDETKDVLVEFYAPWCGHCKNLAPTYEKLAEEYSDD 405



 Score = 59.3 bits (137), Expect = 7e-10
 Identities = 22/47 (46%), Positives = 34/47 (72%)
 Frame = +2

Query: 119 LSKANFETVITTTEYILVEFYAPWCGHCKSLAPEYAKAATKLAEEDL 259
           ++K     +IT  + ++V+FYAPWCGHCK+LAPEY  AA +L ++ +
Sbjct: 27  VNKEGLNELITADKVLMVKFYAPWCGHCKALAPEYESAADELEKDGI 73



 Score = 37.9 bits (84), Expect = 0.002
 Identities = 20/57 (35%), Positives = 36/57 (63%), Gaps = 3/57 (5%)
 Frame = +1

Query: 256 SPIKLAKVDATQEQDLAESYGVRGYPTLKFFRNG---SPIDYSGGRQADDIISWLKK 417
           S + +AK+DAT E D++ S  + G+PT+ FF+     +P+ Y G R  +D+ +++ K
Sbjct: 406 SNVVVAKIDAT-ENDISVS--ISGFPTIMFFKANDKVNPVRYEGDRTLEDLSAFIDK 459


>SPAC13F5.05 |||thioredoxin family protein|Schizosaccharomyces
           pombe|chr 1|||Manual
          Length = 363

 Score = 50.8 bits (116), Expect = 3e-07
 Identities = 24/67 (35%), Positives = 31/67 (46%)
 Frame = +2

Query: 44  LIFTAIALLGLALGDEVPTEENVLVLSKANFETVITTTEYILVEFYAPWCGHCKSLAPEY 223
           L     +L+    G       N + L+  NF   +      LV FYAPWCG+CK L P Y
Sbjct: 11  LFLACFSLVSGVFGYSPMFGSNTIELNSKNFRKFVKAKGPSLVVFYAPWCGYCKKLVPTY 70

Query: 224 AKAATKL 244
            K A+ L
Sbjct: 71  QKLASNL 77



 Score = 30.3 bits (65), Expect = 0.38
 Identities = 19/72 (26%), Positives = 34/72 (47%), Gaps = 6/72 (8%)
 Frame = +1

Query: 259 PIKLAKVDATQEQDLAESYGVRGYPTLKFF---RNGSPI---DYSGGRQADDIISWLKKK 420
           P+     DA Q + +   Y V+G+PT+K       GS +   DY+G R    +  ++   
Sbjct: 82  PVTAVDCDADQNRAVCSQYQVQGFPTIKLVYPSSKGSSLSSTDYNGDRSYKSLQKFVSDS 141

Query: 421 TGPPAVEVTSAE 456
             P  V++ ++E
Sbjct: 142 I-PSKVKILTSE 152


>SPAC17H9.14c |||protein disulfide isomerase|Schizosaccharomyces
           pombe|chr 1|||Manual
          Length = 359

 Score = 48.8 bits (111), Expect = 1e-06
 Identities = 21/40 (52%), Positives = 27/40 (67%), Gaps = 1/40 (2%)
 Frame = +2

Query: 107 NVLVLSKANFETVITTTEY-ILVEFYAPWCGHCKSLAPEY 223
           NV+ L   NF+ V+   +  +LVEFYA WCG+CK LAP Y
Sbjct: 141 NVVELDSLNFDKVVMDDKKDVLVEFYADWCGYCKRLAPTY 180



 Score = 48.0 bits (109), Expect = 2e-06
 Identities = 24/76 (31%), Positives = 40/76 (52%), Gaps = 2/76 (2%)
 Frame = +1

Query: 262 IKLAKVDATQEQDLAESYGVRGYPTLKFF-RNGS-PIDYSGGRQADDIISWLKKKTGPPA 435
           + + K+DA    D+A+ Y + G+PTL +F  +GS P+ YS  R  D +  ++ +KTG   
Sbjct: 74  VLIGKIDADTHSDVADKYHITGFPTLIWFPPDGSEPVQYSNARDVDSLTQFVSEKTGIKK 133

Query: 436 VEVTSAEQAKELIDAN 483
            ++       EL   N
Sbjct: 134 RKIVLPSNVVELDSLN 149



 Score = 46.4 bits (105), Expect = 5e-06
 Identities = 24/65 (36%), Positives = 34/65 (52%)
 Frame = +2

Query: 29  IEMRVLIFTAIALLGLALGDEVPTEENVLVLSKANFETVITTTEYILVEFYAPWCGHCKS 208
           + + +L F   AL  L     V   +++  L      T+  + +  L+EFYA WCGHCKS
Sbjct: 1   MRLPLLSFVIFALFALVFASGVVELQSLNELEN----TIRASKKGALIEFYATWCGHCKS 56

Query: 209 LAPEY 223
           LAP Y
Sbjct: 57  LAPVY 61



 Score = 37.1 bits (82), Expect = 0.003
 Identities = 17/58 (29%), Positives = 31/58 (53%), Gaps = 3/58 (5%)
 Frame = +1

Query: 262 IKLAKVDATQEQDLAESYGVRGYPTLKFF---RNGSPIDYSGGRQADDIISWLKKKTG 426
           +++ K++A    D+   + V  +PT+KFF       P  Y G R  + +I ++ KK+G
Sbjct: 193 VEIVKINADVFADIGRLHEVASFPTIKFFPKDDKDKPELYEGDRSLESLIEYINKKSG 250


>SPAC7D4.07c |trx1||cytosolic thioredoxin Trx1 |Schizosaccharomyces
           pombe|chr 1|||Manual
          Length = 103

 Score = 41.1 bits (92), Expect = 2e-04
 Identities = 12/36 (33%), Positives = 26/36 (72%)
 Frame = +2

Query: 116 VLSKANFETVITTTEYILVEFYAPWCGHCKSLAPEY 223
           V   + F++++   + ++V+F+A WCG CK++AP++
Sbjct: 5   VSDSSEFKSIVCQDKLVVVDFFATWCGPCKAIAPKF 40



 Score = 27.1 bits (57), Expect = 3.6
 Identities = 11/32 (34%), Positives = 17/32 (53%)
 Frame = +1

Query: 274 KVDATQEQDLAESYGVRGYPTLKFFRNGSPID 369
           KVD  Q  ++A   GV   P+   ++NG  I+
Sbjct: 54  KVDVDQLSEIAAEAGVHAMPSFFLYKNGEKIE 85


>SPBC577.08c |txl1|trx3|thioredoxin-like I protein
           Txl1|Schizosaccharomyces pombe|chr 2|||Manual
          Length = 290

 Score = 39.5 bits (88), Expect = 6e-04
 Identities = 15/44 (34%), Positives = 29/44 (65%)
 Frame = +2

Query: 116 VLSKANFETVITTTEYILVEFYAPWCGHCKSLAPEYAKAATKLA 247
           + S  ++ + I  + Y+ V+ YA WCG CK+++P +++ A+K A
Sbjct: 6   IRSYQHWISTIPKSGYLAVDCYADWCGPCKAISPLFSQLASKYA 49



 Score = 35.9 bits (79), Expect = 0.008
 Identities = 23/69 (33%), Positives = 34/69 (49%), Gaps = 4/69 (5%)
 Frame = +1

Query: 271 AKVDATQEQDLAESYGVRGYPTLKFFRNGSPIDYSGGR--QA--DDIISWLKKKTGPPAV 438
           AKV+  +++ +A   GV+  PT  FF NG  ID   G   QA  + +     K TG  A+
Sbjct: 56  AKVNVDEQRQIASGLGVKAMPTFVFFENGKQIDMLTGANPQALKEKVALISSKATGTGAL 115

Query: 439 EVTSAEQAK 465
             +S+   K
Sbjct: 116 ASSSSAPVK 124


>SPAC959.05c |||protein disulfide isomerase |Schizosaccharomyces
           pombe|chr 1|||Manual
          Length = 632

 Score = 36.3 bits (80), Expect = 0.006
 Identities = 12/65 (18%), Positives = 36/65 (55%)
 Frame = +1

Query: 262 IKLAKVDATQEQDLAESYGVRGYPTLKFFRNGSPIDYSGGRQADDIISWLKKKTGPPAVE 441
           +K+A+V+  +E+++   + ++ +PT + F+    I Y+G  +   ++S+  +     A++
Sbjct: 230 LKMAQVNCDEEKEMCNHFHIKKFPTFRVFQGFDSIQYNGPLKYQQLLSYSNQVASYQAIK 289

Query: 442 VTSAE 456
           +   +
Sbjct: 290 IEEGD 294



 Score = 28.3 bits (60), Expect = 1.6
 Identities = 18/54 (33%), Positives = 25/54 (46%), Gaps = 5/54 (9%)
 Frame = +1

Query: 301 LAESYGVRGYPTLKFFRNGSPIDYSG--GRQADD---IISWLKKKTGPPAVEVT 447
           LA  YG +  P++   RNG PI Y     R+  D   I  W+   + P   E+T
Sbjct: 343 LANKYGAQSQPSIIAVRNGMPIVYQAITPREFRDYKRITEWINIVSSPFITELT 396


>SPBC12D12.07c |trx2||mitochondrial thioredoxin
           Trx2|Schizosaccharomyces pombe|chr 2|||Manual
          Length = 121

 Score = 36.3 bits (80), Expect = 0.006
 Identities = 15/34 (44%), Positives = 21/34 (61%)
 Frame = +2

Query: 116 VLSKANFETVITTTEYILVEFYAPWCGHCKSLAP 217
           V S  ++ T I+  +  +V+FYA WCG CK L P
Sbjct: 22  VESFGDYNTRISADKVTVVDFYADWCGPCKYLKP 55



 Score = 31.1 bits (67), Expect = 0.22
 Identities = 16/47 (34%), Positives = 23/47 (48%)
 Frame = +1

Query: 277 VDATQEQDLAESYGVRGYPTLKFFRNGSPIDYSGGRQADDIISWLKK 417
           V+A +  D+A+  GV   PT+  FR G  +D   G     + S L K
Sbjct: 72  VNADKFSDIAQKNGVYALPTMVLFRKGQELDRIVGADVKTLSSLLAK 118


>SPBC3D6.13c |||protein disulfide isomerase |Schizosaccharomyces
           pombe|chr 2|||Manual
          Length = 726

 Score = 30.7 bits (66), Expect = 0.29
 Identities = 11/55 (20%), Positives = 29/55 (52%)
 Frame = +1

Query: 253 RSPIKLAKVDATQEQDLAESYGVRGYPTLKFFRNGSPIDYSGGRQADDIISWLKK 417
           R  + +A ++    +   + Y ++ +PT  FF+  + ++Y G     D++S+ ++
Sbjct: 328 RGKLNVAHINCAVSKRACKQYSIQYFPTFLFFKEEAFVEYVGLPNEGDLVSFAEE 382



 Score = 28.3 bits (60), Expect = 1.6
 Identities = 10/28 (35%), Positives = 15/28 (53%)
 Frame = +2

Query: 170 VEFYAPWCGHCKSLAPEYAKAATKLAEE 253
           +++Y P CG CK L P +     K  E+
Sbjct: 47  IKYYLPSCGACKRLGPMWDNMVEKAKEQ 74


>SPBC26H8.06 |grx4||glutaredoxin Grx4|Schizosaccharomyces pombe|chr
           2|||Manual
          Length = 244

 Score = 27.9 bits (59), Expect = 2.1
 Identities = 9/18 (50%), Positives = 12/18 (66%)
 Frame = +2

Query: 158 EYILVEFYAPWCGHCKSL 211
           + IL+ FYAPW   CK +
Sbjct: 21  QIILLNFYAPWAAPCKQM 38


>SPAC589.02c |med13|spTrap240, srb9|mediator complex subunit
           Srb9|Schizosaccharomyces pombe|chr 1|||Manual
          Length = 1223

 Score = 27.5 bits (58), Expect = 2.7
 Identities = 14/41 (34%), Positives = 19/41 (46%)
 Frame = +3

Query: 105 KMCSF*VKLTLKL*LQPRSTF*LNSMLHGAATANLWHRNTP 227
           K  +F       L LQP  T   N +L+   + NLW R+ P
Sbjct: 620 KSANFDFSFLKSLDLQPTITLGKNDLLNAILSQNLWFRSLP 660


>SPAC1142.01 ||SPAC17G6.18|DUF654 family protein|Schizosaccharomyces
           pombe|chr 1|||Manual
          Length = 667

 Score = 27.5 bits (58), Expect = 2.7
 Identities = 23/76 (30%), Positives = 33/76 (43%), Gaps = 1/76 (1%)
 Frame = +3

Query: 510 DQSSARAKTF-LSTAQVVDDQVFAIVSDEKVIKELEAEDEDVVLFKNFEEKRVKYXDEEI 686
           +QSS   K   L +++ +DD +  I      +K    E + V      EE      D+E+
Sbjct: 119 NQSSDNEKLEGLESSKNIDDDIDEIEKAAAELKLKYREQDQVEHVAGVEESATIPLDKEL 178

Query: 687 TEDLLNALGVVQSMAN 734
            E L   LGV  SM N
Sbjct: 179 DEKLNKLLGVNISMLN 194


>SPCC18.03 |||shuttle craft like transcriptional
           regulator|Schizosaccharomyces pombe|chr 3|||Manual
          Length = 1077

 Score = 25.8 bits (54), Expect = 8.3
 Identities = 14/35 (40%), Positives = 17/35 (48%)
 Frame = +3

Query: 783 GKDSKYPXFLTFLIPEKMGGFRGKXPXXDFENPVP 887
           GK  K P F+  L+P   G   GK    D E+P P
Sbjct: 262 GKQEK-PEFVKNLVPHSCGDPCGKTRGQDCEHPCP 295


  Database: spombe
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 2,362,478
  Number of sequences in database:  5004
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 3,490,021
Number of Sequences: 5004
Number of extensions: 68694
Number of successful extensions: 209
Number of sequences better than 10.0: 12
Number of HSP's better than 10.0 without gapping: 190
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 208
length of database: 2,362,478
effective HSP length: 72
effective length of database: 2,002,190
effective search space used: 448490560
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -