SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= psV30165.Seq
         (897 letters)

Database: spombe 
           5004 sequences; 2,362,478 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SPBC3B8.02 |php5||CCAAT-binding factor complex subunit Php5|Schi...    86   7e-18
SPAC17G8.03c |dpb3||DNA polymerase epsilon subunit Dpb3|Schizosa...    42   9e-05
SPAC24B11.12c |||P-type ATPase |Schizosaccharomyces pombe|chr 1|...    27   3.6  
SPCPJ732.03 |meu15||sequence orphan|Schizosaccharomyces pombe|ch...    26   8.4  
SPAPB24D3.08c |||NADP-dependent oxidoreductase |Schizosaccharomy...    26   8.4  

>SPBC3B8.02 |php5||CCAAT-binding factor complex subunit
           Php5|Schizosaccharomyces pombe|chr 2|||Manual
          Length = 415

 Score = 85.8 bits (203), Expect = 7e-18
 Identities = 42/77 (54%), Positives = 57/77 (74%), Gaps = 2/77 (2%)
 Frame = +1

Query: 286 AQTLQQFWDKVLEDIQKVNSEDFKTQALPLARIKKIMKLDEEVK--MISAEAPVLFAKAA 459
           AQ L ++W K ++ ++  + +  KT  LPLARIKK+MK D++VK  MISAEAP LFAK +
Sbjct: 83  AQALAEYWQKTIDTLEH-DDQAVKTLHLPLARIKKVMKTDDDVKNKMISAEAPFLFAKGS 141

Query: 460 EIFIHELTLRAWSHTEE 510
           EIFI ELT+RAW H ++
Sbjct: 142 EIFIAELTMRAWLHAKK 158


>SPAC17G8.03c |dpb3||DNA polymerase epsilon subunit
           Dpb3|Schizosaccharomyces pombe|chr 1|||Manual
          Length = 199

 Score = 42.3 bits (95), Expect = 9e-05
 Identities = 19/57 (33%), Positives = 32/57 (56%)
 Frame = +1

Query: 334 KVNSEDFKTQALPLARIKKIMKLDEEVKMISAEAPVLFAKAAEIFIHELTLRAWSHT 504
           K N   +     P+ARIKKIM+ D++V  ++   PV+ +KA E+F+  +   +   T
Sbjct: 13  KPNPATYWKSRFPVARIKKIMQADQDVGKVAQVTPVIMSKALELFMQSIIQESCKQT 69


>SPAC24B11.12c |||P-type ATPase |Schizosaccharomyces pombe|chr
            1|||Manual
          Length = 1402

 Score = 27.1 bits (57), Expect = 3.6
 Identities = 11/35 (31%), Positives = 18/35 (51%)
 Frame = -1

Query: 189  WTFCSFFNQLHETNAPMFLFNYHSKLILKLCFGKL 85
            WTF  F+ Q++      +LF+Y   ++  L F  L
Sbjct: 1080 WTFTLFWYQIYNNFDANYLFDYTYVMLFNLIFSSL 1114


>SPCPJ732.03 |meu15||sequence orphan|Schizosaccharomyces pombe|chr
           3|||Manual
          Length = 150

 Score = 25.8 bits (54), Expect = 8.4
 Identities = 11/21 (52%), Positives = 14/21 (66%)
 Frame = +1

Query: 340 NSEDFKTQALPLARIKKIMKL 402
           N ++ K Q LPL  IKKI K+
Sbjct: 16  NLQEVKPQVLPLEEIKKIYKI 36


>SPAPB24D3.08c |||NADP-dependent oxidoreductase |Schizosaccharomyces
           pombe|chr 1|||Manual
          Length = 349

 Score = 25.8 bits (54), Expect = 8.4
 Identities = 9/17 (52%), Positives = 13/17 (76%)
 Frame = +1

Query: 625 LRRRXESPQHGSVLPPV 675
           LR R +SP+H S +PP+
Sbjct: 59  LRMRMQSPKHASYIPPL 75


  Database: spombe
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 2,362,478
  Number of sequences in database:  5004
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 3,125,780
Number of Sequences: 5004
Number of extensions: 56622
Number of successful extensions: 147
Number of sequences better than 10.0: 5
Number of HSP's better than 10.0 without gapping: 138
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 146
length of database: 2,362,478
effective HSP length: 72
effective length of database: 2,002,190
effective search space used: 452494940
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -