SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= psV30164.Seq
         (888 letters)

Database: spombe 
           5004 sequences; 2,362,478 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SPAC1565.08 |cdc48|SPAC6F12.01|AAA family ATPase Cdc48|Schizosac...   118   8e-28
SPAC1556.02c |sdh1||succinate dehydrogenase Sdh1|Schizosaccharom...    30   0.38 
SPAC13C5.05c |||N-acetylglucosamine-phosphate mutase |Schizosacc...    30   0.51 
SPAC5D6.01 |rps2202|rps22-2, rps15a-2|40S ribosomal protein S15a...    29   1.2  
SPAC22A12.04c |rps2201|rps22-1, rps15a-1|40S ribosomal protein S...    29   1.2  
SPAC4D7.02c |||glycerophosphoryl diester phosphodiesterase |Schi...    28   1.5  
SPAC12G12.01c ||SPAC630.02|ubiquitin-protein ligase E3|Schizosac...    28   2.0  
SPCC285.10c |||SPRY domain protein|Schizosaccharomyces pombe|chr...    27   3.6  
SPAPJ698.02c |rps002|rpsa-2, rps0-2, rps0|40S ribosomal protein ...    27   4.7  
SPBC1709.08 |cft1||cleavage factor one Cft1 |Schizosaccharomyces...    26   6.2  
SPBP4G3.03 |||PI31 proteasome regulator related|Schizosaccharomy...    26   6.2  
SPBC685.03 |||sequence orphan|Schizosaccharomyces pombe|chr 2|||...    26   8.2  
SPBC428.15 |||GTP binding protein|Schizosaccharomyces pombe|chr ...    26   8.2  
SPBC56F2.07c |||AAA family ATPase, unknown biological role|Schiz...    26   8.2  
SPCC645.06c |rgf3|lad1|RhoGEF Rgf3|Schizosaccharomyces pombe|chr...    26   8.2  

>SPAC1565.08 |cdc48|SPAC6F12.01|AAA family ATPase
           Cdc48|Schizosaccharomyces pombe|chr 1|||Manual
          Length = 815

 Score =  118 bits (285), Expect = 8e-28
 Identities = 80/224 (35%), Positives = 118/224 (52%), Gaps = 2/224 (0%)
 Frame = +1

Query: 223 LAQGQTPQGNRCIVLSDDNCPDEKIRMXXXXXXXXXXXXSDVVSIAPCPSVKYGKRVHIL 402
           + +G+  +    IVL+D+   D   R+             D+V+I PCP +KY +R+ +L
Sbjct: 78  VVKGKRRKDTVLIVLTDEEMEDGVARINRVVRNNLRVRLGDIVTINPCPDIKYAERISVL 137

Query: 403 PIDDSVEGLTGNLFEVYLKPYFMEAYRPIHRDDTFRSAGACAPSSSKWSKQIHHHFASWL 582
           P+ D+VEGLTG+LF+VYLKPYF+EAYRPI + D F   G+      K        F   +
Sbjct: 138 PLADTVEGLTGSLFDVYLKPYFVEAYRPIRKGDLFVVRGSMRQVEFKVVDVAPDEFG--I 195

Query: 583 LIP*YTVTVNRLNVRKKRKH*MLSAMMTSAV--VANNWAQIKEMVELPLRSSFTVSRLLE 756
           +     +      + ++ +   L+ +    +       AQI+E+VELPLR    + + + 
Sbjct: 196 VSQDTIIHWEGEPINREDEESSLAEVGYDDIGGCRRQMAQIRELVELPLRHP-QLFKSIG 254

Query: 757 *KLPRGILHVWGRLVTGKNTHWLVLLLMETGASSFLINGPGIMS 888
            K PRGIL ++G   TGK T     +  ETGA  FLINGP IMS
Sbjct: 255 IKPPRGIL-MYGPPGTGK-TLMARAVANETGAFFFLINGPEIMS 296



 Score = 98.7 bits (235), Expect = 1e-21
 Identities = 58/118 (49%), Positives = 71/118 (60%), Gaps = 2/118 (1%)
 Frame = +3

Query: 510 VRGGMRAVEFKVVETDPSPFCIVAPDTVIHCDGEPIKREEEEEALNAVGYDDIGGCRKQL 689
           VRG MR VEFKVV+  P  F IV+ DT+IH +GEPI RE+EE +L  VGYDDIGGCR+Q+
Sbjct: 174 VRGSMRQVEFKVVDVAPDEFGIVSQDTIIHWEGEPINREDEESSLAEVGYDDIGGCRRQM 233

Query: 690 GAN*GDGGVATAVILH--CFKAIGVKASTRHSPCMGPPXNRKKHSLARAVANGNRGFF 857
                   +    + H   FK+IG+K   R     GPP   K   +ARAVAN    FF
Sbjct: 234 AQ---IRELVELPLRHPQLFKSIGIK-PPRGILMYGPPGTGKT-LMARAVANETGAFF 286



 Score = 88.6 bits (210), Expect = 1e-18
 Identities = 41/68 (60%), Positives = 53/68 (77%)
 Frame = +2

Query: 53  NKMADNKSPDDLSTAILRRKDRPNRLIVEEAVSDDNSVVALSQAKMEQLQLFRGDTVLLK 232
           N   D  S +D +TAILR+K +PN L+V++A +DDNSV+ LS   ME LQLFRGDTV++K
Sbjct: 21  NPPKDTYSAEDTATAILRKKRKPNSLVVDDATNDDNSVITLSSNTMETLQLFRGDTVVVK 80

Query: 233 GKRRKETV 256
           GKRRK+TV
Sbjct: 81  GKRRKDTV 88


>SPAC1556.02c |sdh1||succinate dehydrogenase
           Sdh1|Schizosaccharomyces pombe|chr 1|||Manual
          Length = 641

 Score = 30.3 bits (65), Expect = 0.38
 Identities = 19/56 (33%), Positives = 28/56 (50%), Gaps = 1/56 (1%)
 Frame = -2

Query: 548 DHFELDGAHAPAD-LKVSSRWIGR*ASMKYGFKYTSNRLPVRPSTESSIGSMWTRF 384
           DH  L  +H PA+ LK     I   A++  G   T   +PV P+   ++G + TRF
Sbjct: 355 DHCYLQLSHLPAEILKERLPGISETAAIFAGVDVTKEPIPVLPTVHYNMGGIPTRF 410


>SPAC13C5.05c |||N-acetylglucosamine-phosphate mutase
           |Schizosaccharomyces pombe|chr 1|||Manual
          Length = 518

 Score = 29.9 bits (64), Expect = 0.51
 Identities = 13/28 (46%), Positives = 18/28 (64%)
 Frame = +1

Query: 799 VTGKNTHWLVLLLMETGASSFLINGPGI 882
           +T    HWLV L+ ++ A+SFL  GP I
Sbjct: 141 ITTPQLHWLVRLINKSTAASFLEEGPPI 168


>SPAC5D6.01 |rps2202|rps22-2, rps15a-2|40S ribosomal protein
           S15a|Schizosaccharomyces pombe|chr 1|||Manual
          Length = 130

 Score = 28.7 bits (61), Expect = 1.2
 Identities = 11/27 (40%), Positives = 19/27 (70%), Gaps = 3/27 (11%)
 Frame = -3

Query: 421 QLNHQLAVCGLV---FHISLKDTERWI 350
           QLN ++  CG++   F++ LKD E+W+
Sbjct: 64  QLNGRINKCGVISPRFNVKLKDIEKWV 90


>SPAC22A12.04c |rps2201|rps22-1, rps15a-1|40S ribosomal protein
           S15a|Schizosaccharomyces pombe|chr 1|||Manual
          Length = 130

 Score = 28.7 bits (61), Expect = 1.2
 Identities = 11/27 (40%), Positives = 19/27 (70%), Gaps = 3/27 (11%)
 Frame = -3

Query: 421 QLNHQLAVCGLV---FHISLKDTERWI 350
           QLN ++  CG++   F++ LKD E+W+
Sbjct: 64  QLNGRINKCGVISPRFNVKLKDIEKWV 90


>SPAC4D7.02c |||glycerophosphoryl diester phosphodiesterase
           |Schizosaccharomyces pombe|chr 1|||Manual
          Length = 319

 Score = 28.3 bits (60), Expect = 1.5
 Identities = 12/39 (30%), Positives = 20/39 (51%), Gaps = 1/39 (2%)
 Frame = +3

Query: 78  LMIYRPRSSVARTDPTVSLSKKQSAMTTQSWH-FHRPKW 191
           L + R    +   DP ++ +  Q  + T+SWH FH  +W
Sbjct: 259 LALIRGCDGLLSDDPVMARALSQGPIVTKSWHYFHYSEW 297


>SPAC12G12.01c ||SPAC630.02|ubiquitin-protein ligase
           E3|Schizosaccharomyces pombe|chr 1|||Manual
          Length = 905

 Score = 27.9 bits (59), Expect = 2.0
 Identities = 14/38 (36%), Positives = 20/38 (52%), Gaps = 1/38 (2%)
 Frame = -3

Query: 391 LVFHISLKDTERWIP-HQKDAHEGCFSQHGSSEFSHQG 281
           LV  + LKD   WI    + + E  F   G ++FS+QG
Sbjct: 435 LVSDLYLKDLWSWIHLSHRQSEESLFGDTGDTDFSYQG 472


>SPCC285.10c |||SPRY domain protein|Schizosaccharomyces pombe|chr
           3|||Manual
          Length = 382

 Score = 27.1 bits (57), Expect = 3.6
 Identities = 19/62 (30%), Positives = 31/62 (50%), Gaps = 2/62 (3%)
 Frame = +3

Query: 27  FLDSNNKF*IKWQIIKALMIYRPRSSVARTDPTVS--LSKKQSAMTTQSWHFHRPKWSNF 200
           F+++N K   KW++  A+    P  S + + PT+S   + + SA TT     +RP  S  
Sbjct: 286 FIEANIK---KWRLAPAVGSLAPPPSYSTSQPTISWDAASESSAGTTTQGDTNRPDKSKN 342

Query: 201 NS 206
            S
Sbjct: 343 RS 344


>SPAPJ698.02c |rps002|rpsa-2, rps0-2, rps0|40S ribosomal protein
           S0B|Schizosaccharomyces pombe|chr 1|||Manual
          Length = 287

 Score = 26.6 bits (56), Expect = 4.7
 Identities = 12/30 (40%), Positives = 18/30 (60%)
 Frame = +3

Query: 576 VAPDTVIHCDGEPIKREEEEEALNAVGYDD 665
           V PD   + D E I+REEE++A  A   ++
Sbjct: 200 VMPDLYFYRDPEEIEREEEQKAAAAAAAEE 229


>SPBC1709.08 |cft1||cleavage factor one Cft1 |Schizosaccharomyces
           pombe|chr 2|||Manual
          Length = 1441

 Score = 26.2 bits (55), Expect = 6.2
 Identities = 20/54 (37%), Positives = 26/54 (48%)
 Frame = -2

Query: 782 WRMPRGSFHSNSLETVKDDRSGNSTISLICAQLFATTADVIIADSI*CFLFFLT 621
           W M   SF +NSL   +D +S N     IC+     T  ++  DS  C L FLT
Sbjct: 135 WDMQSQSFVTNSLHYYEDVKSSN-----ICSS-HTPTQLLVDPDSDCCLLRFLT 182


>SPBP4G3.03 |||PI31 proteasome regulator related|Schizosaccharomyces
           pombe|chr 2|||Manual
          Length = 241

 Score = 26.2 bits (55), Expect = 6.2
 Identities = 14/48 (29%), Positives = 21/48 (43%)
 Frame = -3

Query: 391 LVFHISLKDTERWIPHQKDAHEGCFSQHGSSEFSHQGNYRLRARCNGF 248
           L FH ++ D   W PH+ +   G F  H     + +G +  R    GF
Sbjct: 177 LGFHPNVGDYFDWYPHRPNHFGGKFDGHSRGRGAGRGGFCGRHGRGGF 224


>SPBC685.03 |||sequence orphan|Schizosaccharomyces pombe|chr
           2|||Manual
          Length = 452

 Score = 25.8 bits (54), Expect = 8.2
 Identities = 14/47 (29%), Positives = 25/47 (53%)
 Frame = +3

Query: 99  SSVARTDPTVSLSKKQSAMTTQSWHFHRPKWSNFNSSVVTQSCSRAN 239
           SSV       S S   ++M++ + +F+    S+ +SSV T + S +N
Sbjct: 329 SSVVIVQSETSCSINSASMSSNTTYFYWNSTSSLSSSVFTNTTSSSN 375


>SPBC428.15 |||GTP binding protein|Schizosaccharomyces pombe|chr
           2|||Manual
          Length = 409

 Score = 25.8 bits (54), Expect = 8.2
 Identities = 11/27 (40%), Positives = 19/27 (70%), Gaps = 1/27 (3%)
 Frame = +2

Query: 77  PD-DLSTAILRRKDRPNRLIVEEAVSD 154
           PD D + + + RK+ PNRL++  A+S+
Sbjct: 233 PDADANISKIARKEDPNRLVLASAISE 259


>SPBC56F2.07c |||AAA family ATPase, unknown biological
           role|Schizosaccharomyces pombe|chr 2|||Manual
          Length = 809

 Score = 25.8 bits (54), Expect = 8.2
 Identities = 21/61 (34%), Positives = 31/61 (50%)
 Frame = +1

Query: 694 QIKEMVELPLRSSFTVSRLLE*KLPRGILHVWGRLVTGKNTHWLVLLLMETGASSFLING 873
           ++KE VE PL    T SR L  + P+G+L ++G     K T     +  ETG +   + G
Sbjct: 559 KLKESVEWPLTHGETFSR-LGVRPPKGVL-LYGPPGCSK-TITAKAIATETGLNFIAVKG 615

Query: 874 P 876
           P
Sbjct: 616 P 616


>SPCC645.06c |rgf3|lad1|RhoGEF Rgf3|Schizosaccharomyces pombe|chr
           3|||Manual
          Length = 1275

 Score = 25.8 bits (54), Expect = 8.2
 Identities = 14/53 (26%), Positives = 30/53 (56%)
 Frame = +2

Query: 50  LNKMADNKSPDDLSTAILRRKDRPNRLIVEEAVSDDNSVVALSQAKMEQLQLF 208
           L  +A N   + L+T   +RK + N  ++ +A ++ N+  +++ A  E+ QL+
Sbjct: 768 LGSLAGNLPQESLTTKS-KRKSKVNLELMFDATAEKNNENSMNSAVFEKSQLY 819


  Database: spombe
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 2,362,478
  Number of sequences in database:  5004
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 3,744,161
Number of Sequences: 5004
Number of extensions: 77118
Number of successful extensions: 238
Number of sequences better than 10.0: 15
Number of HSP's better than 10.0 without gapping: 224
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 236
length of database: 2,362,478
effective HSP length: 72
effective length of database: 2,002,190
effective search space used: 446488370
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -