SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= psV30162.Seq
         (465 letters)

Database: spombe 
           5004 sequences; 2,362,478 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SPAC890.08 |rpl31||60S ribosomal protein L31|Schizosaccharomyces...    88   5e-19
SPAC105.01c |||potassium ion/proton antiporter|Schizosaccharomyc...    30   0.20 
SPAC1F8.03c |str3||siderophore-iron transporter Str3 |Schizosacc...    27   1.9  
SPBPB8B6.02c |||urea transporter |Schizosaccharomyces pombe|chr ...    26   3.3  
SPCC4G3.16 |||CMP/dCMP deaminase family|Schizosaccharomyces pomb...    25   4.3  
SPAC1F7.01c |spt6|SPAC694.07c|transcription elongation factor Sp...    25   7.5  
SPAC23D3.13c |||guanyl-nucleotide exchange factor|Schizosaccharo...    24   9.9  
SPAC806.08c |mod21||gamma tubulin complex subunit Mod21|Schizosa...    24   9.9  

>SPAC890.08 |rpl31||60S ribosomal protein L31|Schizosaccharomyces
           pombe|chr 1|||Manual
          Length = 113

 Score = 88.2 bits (209), Expect = 5e-19
 Identities = 40/57 (70%), Positives = 49/57 (85%)
 Frame = +2

Query: 83  KSAINEVVTREYTVNLHKRLHGVGFKKRAPRAIKEIRKFAEKQMGTPDIRVDTRLNK 253
           KSAIN+VVTR+YT+++HKRL+GV FKKRAPRAIKEI  FA+K M T ++RVD  LNK
Sbjct: 6   KSAINQVVTRDYTIHMHKRLYGVSFKKRAPRAIKEIVAFAQKHMQTKEVRVDPSLNK 62



 Score = 33.9 bits (74), Expect = 0.012
 Identities = 18/49 (36%), Positives = 27/49 (55%)
 Frame = +1

Query: 241 SLKQILWSKGVRNVPFXXXXXXXXXXNDDEDSAHKLFTLVTYVPVASIK 387
           SL + +W +G+RNVP           +D++D A  L+T V  V VA+ K
Sbjct: 59  SLNKEVWKRGIRNVPHRLRLRLSRKRSDEDDKA--LYTYVQAVDVANPK 105


>SPAC105.01c |||potassium ion/proton antiporter|Schizosaccharomyces
           pombe|chr 1|||Manual
          Length = 898

 Score = 29.9 bits (64), Expect = 0.20
 Identities = 21/72 (29%), Positives = 31/72 (43%)
 Frame = -1

Query: 231 RMSGVPICFSANFRISLIALGARFLNPTP*SRLCKLTVYSRVTTSFMADLPFLSPLGLAI 52
           R+  +P+ F    R+    +G   L PT   R+ K   Y    TS M  L  +S LGL +
Sbjct: 45  RLIHIPLSFLQQPRVIAEIIGGIVLGPTVMGRIPKFLDYI-FPTSSMGPLNLVSNLGLVL 103

Query: 51  VILSFVYRIQLR 16
            +      + LR
Sbjct: 104 FLFVIGMEVDLR 115


>SPAC1F8.03c |str3||siderophore-iron transporter Str3
           |Schizosaccharomyces pombe|chr 1|||Manual
          Length = 630

 Score = 26.6 bits (56), Expect = 1.9
 Identities = 11/36 (30%), Positives = 19/36 (52%)
 Frame = -3

Query: 241 SVYSNVRSSHLFFSELSDFFDCSWGTLFKSNTMKSF 134
           S+Y N R  +L ++       CSW +  +S+T  S+
Sbjct: 73  SIYQNKRGMYLAYAFGIAILACSWASAIQSSTTYSY 108


>SPBPB8B6.02c |||urea transporter |Schizosaccharomyces pombe|chr
           2|||Manual
          Length = 673

 Score = 25.8 bits (54), Expect = 3.3
 Identities = 9/18 (50%), Positives = 13/18 (72%)
 Frame = -2

Query: 431 GVYSWLASTFSVCKPLID 378
           GV  WLAST+S C  +++
Sbjct: 464 GVVCWLASTYSFCDGIVN 481


>SPCC4G3.16 |||CMP/dCMP deaminase family|Schizosaccharomyces
           pombe|chr 3|||Manual
          Length = 405

 Score = 25.4 bits (53), Expect = 4.3
 Identities = 12/34 (35%), Positives = 17/34 (50%)
 Frame = +1

Query: 187 NPKVR*KTDGNSGHSSRHSLKQILWSKGVRNVPF 288
           N  ++ K    S H SR S   +LW   V+ VP+
Sbjct: 48  NKPIKVKQSLQSLHQSRGSTGSVLWKTSVKVVPW 81


>SPAC1F7.01c |spt6|SPAC694.07c|transcription elongation factor
           Spt6|Schizosaccharomyces pombe|chr 1|||Manual
          Length = 1365

 Score = 24.6 bits (51), Expect = 7.5
 Identities = 12/33 (36%), Positives = 20/33 (60%)
 Frame = +2

Query: 92  INEVVTREYTVNLHKRLHGVGFKKRAPRAIKEI 190
           INE VT +Y  N+   + G+G  ++A   +K+I
Sbjct: 860 INEAVTNKYEANILPYIAGLG-PRKADYVLKKI 891


>SPAC23D3.13c |||guanyl-nucleotide exchange factor|Schizosaccharomyces
            pombe|chr 1|||Manual
          Length = 1616

 Score = 24.2 bits (50), Expect = 9.9
 Identities = 12/27 (44%), Positives = 17/27 (62%)
 Frame = -1

Query: 120  VYSRVTTSFMADLPFLSPLGLAIVILS 40
            V+   +TSF  D+ FLS L LA+  L+
Sbjct: 1237 VFYEESTSFALDVDFLSSLQLAVESLT 1263


>SPAC806.08c |mod21||gamma tubulin complex subunit
           Mod21|Schizosaccharomyces pombe|chr 1|||Manual
          Length = 618

 Score = 24.2 bits (50), Expect = 9.9
 Identities = 11/27 (40%), Positives = 16/27 (59%)
 Frame = -3

Query: 376 QQARKSLV*ITYVRNLHHHYVFVKASH 296
           ++A+KSL    + R  + HYVFV   H
Sbjct: 452 EEAKKSLWSKRFSRFYYGHYVFVNTCH 478


  Database: spombe
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 2,362,478
  Number of sequences in database:  5004
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 1,739,338
Number of Sequences: 5004
Number of extensions: 32305
Number of successful extensions: 64
Number of sequences better than 10.0: 8
Number of HSP's better than 10.0 without gapping: 63
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 64
length of database: 2,362,478
effective HSP length: 67
effective length of database: 2,027,210
effective search space used: 176367270
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -