SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= psV30161.Seq
         (888 letters)

Database: spombe 
           5004 sequences; 2,362,478 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SPBC3H7.07c |||phosphoserine phosphatase |Schizosaccharomyces po...    58   2e-09
SPBPJ4664.02 |||glycoprotein |Schizosaccharomyces pombe|chr 2|||...    37   0.004
SPBC1E8.05 |||conserved fungal protein|Schizosaccharomyces pombe...    35   0.018
SPBC30B4.01c |wsc1|SPBC3D6.14c|transmembrane receptor Wsc1 |Schi...    33   0.054
SPBC215.13 |||sequence orphan|Schizosaccharomyces pombe|chr 2|||...    33   0.072
SPCC1322.10 |||conserved fungal protein|Schizosaccharomyces pomb...    30   0.51 
SPAPB18E9.04c |||sequence orphan|Schizosaccharomyces pombe|chr 1...    29   0.67 
SPAPB15E9.01c ||SPAPB18E9.06c|sequence orphan|Schizosaccharomyce...    29   0.88 
SPAC7D4.11c |sec39||secretory pathway protein Sec39 |Schizosacch...    29   1.2  
SPBC21D10.06c |map4||cell agglutination protein Map4|Schizosacch...    29   1.2  
SPAC4F10.02 |||aminopeptidase |Schizosaccharomyces pombe|chr 1||...    28   1.5  
SPAC11G7.01 |||sequence orphan|Schizosaccharomyces pombe|chr 1||...    28   2.0  
SPCC757.12 |||alpha-amylase homolog |Schizosaccharomyces pombe|c...    28   2.0  
SPAC2E1P3.05c |||fungal cellulose binding domain protein|Schizos...    27   2.7  
SPAC1834.11c |sec18||secretory pathway protein Sec18 |Schizosacc...    27   2.7  
SPAC16C9.02c |||S-methyl-5-thioadenosine phosphorylase|Schizosac...    27   3.6  
SPBC23G7.08c |rga7||GTPase activating protein Rga7|Schizosacchar...    27   4.7  
SPCC18.01c |adg3|SPCC74.07c|beta-glucosidase Adg3 |Schizosacchar...    27   4.7  
SPAC17A5.07c |ulp2||SUMO deconjugating cysteine peptidase Ulp2 |...    26   6.2  
SPBP23A10.11c |||conserved fungal protein|Schizosaccharomyces po...    26   8.2  
SPAC22A12.09c |sap114||splicing factor Sap114|Schizosaccharomyce...    26   8.2  
SPBC1921.03c |mex67||mRNA export receptor Mex67|Schizosaccharomy...    26   8.2  

>SPBC3H7.07c |||phosphoserine phosphatase |Schizosaccharomyces
           pombe|chr 2|||Manual
          Length = 298

 Score = 58.0 bits (134), Expect = 2e-09
 Identities = 39/106 (36%), Positives = 58/106 (54%), Gaps = 4/106 (3%)
 Frame = +1

Query: 196 DVEDALTGVDQRDVAPTDC--PELFRTAD-CVCFDVDSTVIQDEGIDELAKFCGKGDEVK 366
           D +DA   +   +    +C     F T    V FD+DST+IQ E IDELA   G   EV 
Sbjct: 48  DAKDACNRISATENVDCNCLSEATFSTKKKLVVFDMDSTLIQQECIDELAAEAGIQKEVA 107

Query: 367 RLTAEAMGGNMTFQEALKKRLDIIRP-NVGQIREFIEKFPVRLTPG 501
            +T+ AM G + FQE+L++R+ +++  +V  I + I K  +  TPG
Sbjct: 108 TITSLAMNGEIDFQESLRRRVSLLQGLSVDVINKVIGK--ITFTPG 151


>SPBPJ4664.02 |||glycoprotein |Schizosaccharomyces pombe|chr
            2|||Manual
          Length = 3971

 Score = 36.7 bits (81), Expect = 0.004
 Identities = 26/71 (36%), Positives = 41/71 (57%), Gaps = 3/71 (4%)
 Frame = -2

Query: 389  PIASAVSLLTSSPFPQN-LASSSMPSSCMTVESTSKQ-TQSAVLNNSGQSVGAT-SR*ST 219
            PI S+ +L TS+P   + + +SS P +  TV +TS   T S+VLN+S     +T    ST
Sbjct: 2303 PITSSTALNTSTPITSSSVLNSSTPITSSTVVNTSTPITSSSVLNSSTPITSSTVVNTST 2362

Query: 218  PVRASSTSRTA 186
            P+ +S+   T+
Sbjct: 2363 PITSSTALNTS 2373



 Score = 36.7 bits (81), Expect = 0.004
 Identities = 26/71 (36%), Positives = 41/71 (57%), Gaps = 3/71 (4%)
 Frame = -2

Query: 389  PIASAVSLLTSSPFPQN-LASSSMPSSCMTVESTSKQ-TQSAVLNNSGQSVGAT-SR*ST 219
            PI S+ +L TS+P   + + +SS P +  TV +TS   T S+VLN+S     +T    ST
Sbjct: 2711 PITSSTALNTSTPITSSSVLNSSTPITSSTVVNTSTPITSSSVLNSSTPITSSTVVNTST 2770

Query: 218  PVRASSTSRTA 186
            P+ +S+   T+
Sbjct: 2771 PITSSTALNTS 2781



 Score = 35.1 bits (77), Expect = 0.013
 Identities = 25/71 (35%), Positives = 41/71 (57%), Gaps = 3/71 (4%)
 Frame = -2

Query: 389  PIASAVSLLTSSPFPQN-LASSSMPSSCMTV-ESTSKQTQSAVLNNSGQSVGAT-SR*ST 219
            PI S+ +L TS+P   + + +SS P +  TV  S++  T S+VLN+S     +T    ST
Sbjct: 1067 PITSSTALNTSTPITSSSVLNSSTPITSSTVLNSSTPITSSSVLNSSTPITSSTVVNTST 1126

Query: 218  PVRASSTSRTA 186
            P+ +S+   T+
Sbjct: 1127 PITSSTALNTS 1137



 Score = 34.7 bits (76), Expect = 0.018
 Identities = 25/71 (35%), Positives = 40/71 (56%), Gaps = 3/71 (4%)
 Frame = -2

Query: 389  PIASAVSLLTSSPFPQN-LASSSMPSSCMTVESTSKQ-TQSAVLNNSGQSVGAT-SR*ST 219
            PI S+ +L TS+P   + + +SS P +  T  +TS   T S+VLN+S     +T    ST
Sbjct: 1583 PITSSTALNTSTPITSSSVLNSSTPITSSTALNTSTPITSSSVLNSSTPITSSTVLNSST 1642

Query: 218  PVRASSTSRTA 186
            P+ +S+   T+
Sbjct: 1643 PITSSTALNTS 1653



 Score = 34.7 bits (76), Expect = 0.018
 Identities = 25/71 (35%), Positives = 40/71 (56%), Gaps = 3/71 (4%)
 Frame = -2

Query: 389  PIASAVSLLTSSPFPQN-LASSSMPSSCMTVESTSKQ-TQSAVLNNSGQSVGAT-SR*ST 219
            PI S+ +L TS+P   + + +SS P +  T  +TS   T S+VLN+S     +T    ST
Sbjct: 1847 PITSSTALNTSTPITSSSVLNSSTPITSSTALNTSTPITSSSVLNSSTPITSSTVLNSST 1906

Query: 218  PVRASSTSRTA 186
            P+ +S+   T+
Sbjct: 1907 PITSSTALNTS 1917



 Score = 34.7 bits (76), Expect = 0.018
 Identities = 25/71 (35%), Positives = 40/71 (56%), Gaps = 3/71 (4%)
 Frame = -2

Query: 389  PIASAVSLLTSSPFPQN-LASSSMPSSCMTVESTSKQ-TQSAVLNNSGQSVGAT-SR*ST 219
            PI S+ +L TS+P   + + +SS P +  T  +TS   T S+VLN+S     +T    ST
Sbjct: 2039 PITSSTALNTSTPITSSSVLNSSTPITSSTALNTSTPITSSSVLNSSTPITSSTVLNSST 2098

Query: 218  PVRASSTSRTA 186
            P+ +S+   T+
Sbjct: 2099 PITSSTALNTS 2109



 Score = 33.5 bits (73), Expect = 0.041
 Identities = 25/71 (35%), Positives = 40/71 (56%), Gaps = 3/71 (4%)
 Frame = -2

Query: 389  PIASAVSLLTSSPFPQN-LASSSMPSSCMTVESTSKQ-TQSAVLNNSGQSVGAT-SR*ST 219
            PI S+ +L TS+P   + + +SS P +  T  +TS   T S+VLN+S     +T    ST
Sbjct: 911  PITSSTALNTSTPITSSSVLNSSTPITSSTGLNTSTPITSSSVLNSSTPITSSTVLNSST 970

Query: 218  PVRASSTSRTA 186
            P+ +S+   T+
Sbjct: 971  PITSSTALNTS 981



 Score = 33.5 bits (73), Expect = 0.041
 Identities = 25/71 (35%), Positives = 40/71 (56%), Gaps = 3/71 (4%)
 Frame = -2

Query: 389  PIASAVSLLTSSPFPQN-LASSSMPSSCMTVESTSKQ-TQSAVLNNSGQSVGAT-SR*ST 219
            PI S+ +L TS+    + + +SS P +  TV +TS   T S+VLN+S     +T    ST
Sbjct: 1295 PITSSTALNTSTSITSSSVLNSSTPITSSTVVNTSTPITSSSVLNSSTPITSSTVVNSST 1354

Query: 218  PVRASSTSRTA 186
            P+ +S+   T+
Sbjct: 1355 PITSSTVVNTS 1365



 Score = 32.7 bits (71), Expect = 0.072
 Identities = 24/71 (33%), Positives = 39/71 (54%), Gaps = 3/71 (4%)
 Frame = -2

Query: 389  PIASAVSLLTSSPFPQN--LASSSMPSSCMTVESTSKQTQSAVLNNSGQSVGAT-SR*ST 219
            PI S+  L TS+P   +  L SS+  +S   + S++  T S+VLN+S     +T    ST
Sbjct: 1211 PITSSTVLNTSTPITSSSVLNSSTPITSSSILNSSTPITSSSVLNSSTPITSSTVVNSST 1270

Query: 218  PVRASSTSRTA 186
            P+ +S+   T+
Sbjct: 1271 PITSSTALNTS 1281



 Score = 31.9 bits (69), Expect = 0.13
 Identities = 24/66 (36%), Positives = 38/66 (57%), Gaps = 3/66 (4%)
 Frame = -2

Query: 389  PIASAVSLLTSSPFPQN-LASSSMPSSCMTVESTSKQ-TQSAVLNNSGQSVGAT-SR*ST 219
            PI S+ +L TS+    + + +SS P +  TV +TS   T S+VLN+S     +T    ST
Sbjct: 2639 PITSSTALNTSTSITSSSVLNSSTPITSSTVVNTSTPITSSSVLNSSTPITSSTVVNTST 2698

Query: 218  PVRASS 201
            P+ +S+
Sbjct: 2699 PITSST 2704



 Score = 31.9 bits (69), Expect = 0.13
 Identities = 24/66 (36%), Positives = 38/66 (57%), Gaps = 3/66 (4%)
 Frame = -2

Query: 389  PIASAVSLLTSSPFPQN-LASSSMPSSCMTVESTSKQ-TQSAVLNNSGQSVGAT-SR*ST 219
            PI S+ +L TS+    + + +SS P +  TV +TS   T S+VLN+S     +T    ST
Sbjct: 2867 PITSSTALNTSTSITSSSVLNSSTPITSSTVVNTSTPITSSSVLNSSTPITSSTVVNTST 2926

Query: 218  PVRASS 201
            P+ +S+
Sbjct: 2927 PITSST 2932



 Score = 31.9 bits (69), Expect = 0.13
 Identities = 24/66 (36%), Positives = 38/66 (57%), Gaps = 3/66 (4%)
 Frame = -2

Query: 389  PIASAVSLLTSSPFPQN-LASSSMPSSCMTVESTSKQ-TQSAVLNNSGQSVGAT-SR*ST 219
            PI S+ +L TS+    + + +SS P +  TV +TS   T S+VLN+S     +T    ST
Sbjct: 2963 PITSSTALNTSTSITSSSVLNSSTPITSSTVVNTSTPITSSSVLNSSTPITSSTVVNTST 3022

Query: 218  PVRASS 201
            P+ +S+
Sbjct: 3023 PITSST 3028



 Score = 31.9 bits (69), Expect = 0.13
 Identities = 23/70 (32%), Positives = 39/70 (55%), Gaps = 3/70 (4%)
 Frame = -2

Query: 386  IASAVSLLTSSPFPQN--LASSSMPSSCMTVESTSKQTQSAVLNNSGQSVGAT-SR*STP 216
            I S+ +L TS+P   +  L SS+  +S   + S++  T S+VLN+S     +T    STP
Sbjct: 3324 ITSSTALNTSTPITSSSVLNSSTAITSSSILNSSTPVTSSSVLNSSTPITSSTVVNSSTP 3383

Query: 215  VRASSTSRTA 186
            + +S+   T+
Sbjct: 3384 ITSSTALNTS 3393



 Score = 31.5 bits (68), Expect = 0.17
 Identities = 23/66 (34%), Positives = 38/66 (57%), Gaps = 3/66 (4%)
 Frame = -2

Query: 389  PIASAVSLLTSSPFPQN-LASSSMPSSCMTVESTSKQ-TQSAVLNNSGQ-SVGATSR*ST 219
            PI S+  + TS+P   + + +SS P +  TV +TS   T S+VLN+S   +  +    ST
Sbjct: 2387 PITSSTVVNTSTPITSSSVLNSSTPITSSTVVNTSTSITSSSVLNSSTPITSSSVLNSST 2446

Query: 218  PVRASS 201
            P+ +S+
Sbjct: 2447 PITSST 2452



 Score = 31.1 bits (67), Expect = 0.22
 Identities = 23/66 (34%), Positives = 38/66 (57%), Gaps = 3/66 (4%)
 Frame = -2

Query: 389 PIASAVSLLTSSPFPQN-LASSSMPSSCMTV-ESTSKQTQSAVLNNSGQSVGAT-SR*ST 219
           PI S+  + TS+P   + + +SS P +  TV  S++  T S+VLN+S     +T    ST
Sbjct: 779 PITSSTVVNTSTPITSSSVLNSSTPITSSTVLNSSTPITSSSVLNSSTPITSSTVVNTST 838

Query: 218 PVRASS 201
           P+ +S+
Sbjct: 839 PITSST 844



 Score = 31.1 bits (67), Expect = 0.22
 Identities = 23/71 (32%), Positives = 39/71 (54%), Gaps = 3/71 (4%)
 Frame = -2

Query: 389  PIASAVSLLTSSPFPQN-LASSSMPSSCMTVESTSKQ-TQSAVLNNSGQSVGAT-SR*ST 219
            P+ S+  L +S+P   + + +SS P +  T  +TS   T S+VLN+S     +T    ST
Sbjct: 3359 PVTSSSVLNSSTPITSSTVVNSSTPITSSTALNTSTPITSSSVLNSSTPITSSTVVNSST 3418

Query: 218  PVRASSTSRTA 186
            P+ +S+   T+
Sbjct: 3419 PITSSTALNTS 3429



 Score = 30.7 bits (66), Expect = 0.29
 Identities = 22/66 (33%), Positives = 37/66 (56%), Gaps = 2/66 (3%)
 Frame = -2

Query: 389  PIASAVSLLTSSPFPQNLA-SSSMP-SSCMTVESTSKQTQSAVLNNSGQSVGATSR*STP 216
            PI S+  L +S+P   + A ++S P +S   + S++  T S VLN+S     +T+  ++P
Sbjct: 1595 PITSSSVLNSSTPITSSTALNTSTPITSSSVLNSSTPITSSTVLNSSTPITSSTALNTSP 1654

Query: 215  VRASST 198
               SST
Sbjct: 1655 PITSST 1660



 Score = 30.7 bits (66), Expect = 0.29
 Identities = 23/71 (32%), Positives = 39/71 (54%), Gaps = 3/71 (4%)
 Frame = -2

Query: 389  PIASAVSLLTSSPFPQN-LASSSMPSSCMTVESTSKQ-TQSAVLNNSGQSVGAT-SR*ST 219
            PI S+  + +S+P   + + +SS P +  T  +TS   T S+VLN+S     +T    ST
Sbjct: 2135 PITSSTVVNSSTPITSSSVLNSSTPITSSTALNTSTPITSSSVLNSSTPITSSTVVNSST 2194

Query: 218  PVRASSTSRTA 186
            P+ +S+   T+
Sbjct: 2195 PITSSTVVNTS 2205



 Score = 29.5 bits (63), Expect = 0.67
 Identities = 21/71 (29%), Positives = 40/71 (56%), Gaps = 3/71 (4%)
 Frame = -2

Query: 389 PIASAVSLLTSSPFPQN-LASSSMP-SSCMTVESTSKQTQSAVLNNSGQSVGAT-SR*ST 219
           PI S+  L +S+P   + + ++S P +S   + S++  T S++LN+S     +T    ST
Sbjct: 383 PITSSSVLNSSTPITSSSILNTSTPITSSSVLNSSTPITSSSILNSSTPITSSTVLNSST 442

Query: 218 PVRASSTSRTA 186
           P+ +S+   T+
Sbjct: 443 PITSSTALNTS 453



 Score = 28.7 bits (61), Expect = 1.2
 Identities = 24/83 (28%), Positives = 43/83 (51%), Gaps = 1/83 (1%)
 Frame = -2

Query: 431  SSLFFKASWNVILPPIASAVSLLTSSPFPQNLASSSMPSSCMTVESTSKQTQSAVLNNSG 252
            SS    +S  +    I ++ + +TSS     L SS+  +S   + S++  T S++LN+S 
Sbjct: 3086 SSSVLNSSTAITSSSIVNSSTPITSSSV---LNSSTAITSSSILNSSTPITSSSILNSST 3142

Query: 251  QSVGAT-SR*STPVRASSTSRTA 186
                +T    STP+ +S+T  T+
Sbjct: 3143 PITSSTVVNSSTPITSSTTLNTS 3165



 Score = 28.7 bits (61), Expect = 1.2
 Identities = 23/65 (35%), Positives = 37/65 (56%), Gaps = 3/65 (4%)
 Frame = -2

Query: 386  IASAVSLLTSSPFPQN-LASSSMPSSCMTVESTSKQ-TQSAVLNNSGQSVGAT-SR*STP 216
            I S+  L +S+P   + + +SS P +  TV +TS   T S+VLN+S     +T    STP
Sbjct: 3228 ITSSSVLNSSTPITSSSVLNSSTPITSSTVVNTSTPITSSSVLNSSTPITSSTVVNTSTP 3287

Query: 215  VRASS 201
            + +S+
Sbjct: 3288 ITSST 3292



 Score = 27.9 bits (59), Expect = 2.0
 Identities = 21/67 (31%), Positives = 36/67 (53%), Gaps = 2/67 (2%)
 Frame = -2

Query: 389  PIASAVSLLTSSPFPQNLA-SSSMP-SSCMTVESTSKQTQSAVLNNSGQSVGATSR*STP 216
            PI S+  L +S+P   + A ++S P +S   + S++  T S+VLN S     ++   S+ 
Sbjct: 959  PITSSTVLNSSTPITSSTALNTSTPITSSSVLNSSTPITSSSVLNTSTPITSSSVLNSST 1018

Query: 215  VRASSTS 195
               SST+
Sbjct: 1019 AITSSTA 1025


>SPBC1E8.05 |||conserved fungal protein|Schizosaccharomyces
           pombe|chr 2|||Manual
          Length = 317

 Score = 34.7 bits (76), Expect = 0.018
 Identities = 31/108 (28%), Positives = 56/108 (51%)
 Frame = -2

Query: 494 VSLTGNFSMNSLI*PTLGLMMSSLFFKASWNVILPPIASAVSLLTSSPFPQNLASSSMPS 315
           +S +G  S  S+    +G   SS +F  S +   P  +S+ S  +SSP   +  SSS   
Sbjct: 121 LSYSGTISSTSIAPSMIGTRTSSSYFITS-SSSTP--SSSSSSSSSSPSSSSSKSSSSSK 177

Query: 314 SCMTVESTSKQTQSAVLNNSGQSVGATSR*STPVRASSTSRTAGCFSN 171
           S  +  S+SK + S+  ++S +S  ++S  S    + S+S+++  FS+
Sbjct: 178 SSSSSSSSSKSSSSS--SSSSKSSSSSSSSSKSSASPSSSKSSSKFSS 223



 Score = 33.9 bits (74), Expect = 0.031
 Identities = 20/69 (28%), Positives = 40/69 (57%)
 Frame = -2

Query: 362 TSSPFPQNLASSSMPSSCMTVESTSKQTQSAVLNNSGQSVGATSR*STPVRASSTSRTAG 183
           +S+P   + +SSS PSS  +  S+S ++ S+  ++S  S  ++S   +   +SS+S+++ 
Sbjct: 151 SSTPSSSSSSSSSSPSSSSSKSSSSSKSSSSSSSSSKSSSSSSSSSKSSSSSSSSSKSSA 210

Query: 182 CFSNCKEPS 156
             S+ K  S
Sbjct: 211 SPSSSKSSS 219



 Score = 28.3 bits (60), Expect = 1.5
 Identities = 18/60 (30%), Positives = 32/60 (53%)
 Frame = -2

Query: 335 ASSSMPSSCMTVESTSKQTQSAVLNNSGQSVGATSR*STPVRASSTSRTAGCFSNCKEPS 156
           +SSS PSS  +  S+S  + S+  ++S +S  ++S  S    +SS+S  +   S+    S
Sbjct: 149 SSSSTPSSSSSSSSSSPSSSSSKSSSSSKSSSSSSSSSKSSSSSSSSSKSSSSSSSSSKS 208


>SPBC30B4.01c |wsc1|SPBC3D6.14c|transmembrane receptor Wsc1
           |Schizosaccharomyces pombe|chr 2|||Manual
          Length = 374

 Score = 33.1 bits (72), Expect = 0.054
 Identities = 25/76 (32%), Positives = 41/76 (53%)
 Frame = -2

Query: 383 ASAVSLLTSSPFPQNLASSSMPSSCMTVESTSKQTQSAVLNNSGQSVGATSR*STPVRAS 204
           +S+VS  TSS      +SSS PSS  T  +TS  + S+  ++S  S  ++S  S+   +S
Sbjct: 129 SSSVSSTTSS------SSSSSPSSSSTTTTTSPSSSSSSSSSSSSSSSSSSSSSSSSSSS 182

Query: 203 STSRTAGCFSNCKEPS 156
           S+S ++   S+    S
Sbjct: 183 SSSSSSSSSSSSSSSS 198



 Score = 31.1 bits (67), Expect = 0.22
 Identities = 19/63 (30%), Positives = 36/63 (57%)
 Frame = -2

Query: 383 ASAVSLLTSSPFPQNLASSSMPSSCMTVESTSKQTQSAVLNNSGQSVGATSR*STPVRAS 204
           +S+ +  T+SP   + +SSS  SS  +  S+S  + S+  ++S  S  ++S  S+   +S
Sbjct: 145 SSSSTTTTTSPSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 204

Query: 203 STS 195
           S+S
Sbjct: 205 SSS 207



 Score = 30.3 bits (65), Expect = 0.38
 Identities = 17/64 (26%), Positives = 36/64 (56%)
 Frame = -2

Query: 362 TSSPFPQNLASSSMPSSCMTVESTSKQTQSAVLNNSGQSVGATSR*STPVRASSTSRTAG 183
           +SSP   +  +++ PSS  +  S+S  + S+  ++S  S  ++S  S+   +SS+S ++ 
Sbjct: 141 SSSPSSSSTTTTTSPSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 200

Query: 182 CFSN 171
             S+
Sbjct: 201 SSSS 204


>SPBC215.13 |||sequence orphan|Schizosaccharomyces pombe|chr
           2|||Manual
          Length = 534

 Score = 32.7 bits (71), Expect = 0.072
 Identities = 23/68 (33%), Positives = 43/68 (63%)
 Frame = -2

Query: 389 PIASAVSLLTSSPFPQNLASSSMPSSCMTVESTSKQTQSAVLNNSGQSVGATSR*STPVR 210
           P +S+ S LTSS    +L++SS+PS+     S+S  T S++ ++S  S  ++S  S+ + 
Sbjct: 222 PSSSSSSTLTSS----SLSTSSIPST----SSSSSSTSSSLSSSSSSSTASSSSSSSSII 273

Query: 209 ASSTSRTA 186
           +SS+S ++
Sbjct: 274 SSSSSSSS 281



 Score = 29.5 bits (63), Expect = 0.67
 Identities = 25/89 (28%), Positives = 42/89 (47%), Gaps = 2/89 (2%)
 Frame = -2

Query: 431 SSLFFKASWNVILPPIASAVSLLTSSPFPQNLASS--SMPSSCMTVESTSKQTQSAVLNN 258
           SS    +S +    P  S+ S  TSS    + +SS  S  SS  ++ S+S  + S+  + 
Sbjct: 227 SSTLTSSSLSTSSIPSTSSSSSSTSSSLSSSSSSSTASSSSSSSSIISSSSSSSSSPTST 286

Query: 257 SGQSVGATSR*STPVRASSTSRTAGCFSN 171
           S     ++S  S+P   SST  ++   S+
Sbjct: 287 SSTISSSSSSSSSPTSTSSTISSSSSSSS 315



 Score = 29.5 bits (63), Expect = 0.67
 Identities = 31/117 (26%), Positives = 55/117 (47%), Gaps = 4/117 (3%)
 Frame = -2

Query: 509 PVIPGVSLTGNFSMNSLI*PTLGLMMSSLFFKASWNVILPPIA-SAVSLLTSSPFPQNL- 336
           P     +++ + S +S    T   + SS    +S++  L   + S+ S  +SSP   +  
Sbjct: 283 PTSTSSTISSSSSSSSSPTSTSSTISSSSSSSSSFSSTLSSSSMSSSSSFSSSPTSSSST 342

Query: 335 --ASSSMPSSCMTVESTSKQTQSAVLNNSGQSVGATSR*STPVRASSTSRTAGCFSN 171
             +SSS PSS     +TS    S+  +++  S  +TS  +    +SS+SR A   S+
Sbjct: 343 ISSSSSSPSSSSFSSTTSSSKSSSSFSSTVSSSSSTSSSTLTSSSSSSSRPASSSSH 399



 Score = 27.9 bits (59), Expect = 2.0
 Identities = 22/73 (30%), Positives = 40/73 (54%)
 Frame = -2

Query: 389 PIASAVSLLTSSPFPQNLASSSMPSSCMTVESTSKQTQSAVLNNSGQSVGATSR*STPVR 210
           P +++ S L+SS     ++SSS PSS  +   TS    ++ + ++  S  +T   S+ + 
Sbjct: 202 PTSTSSSYLSSSSV---VSSSSSPSSSSSSTLTSSSLSTSSIPSTSSSSSST---SSSLS 255

Query: 209 ASSTSRTAGCFSN 171
           +SS+S TA   S+
Sbjct: 256 SSSSSSTASSSSS 268


>SPCC1322.10 |||conserved fungal protein|Schizosaccharomyces
           pombe|chr 3|||Manual
          Length = 262

 Score = 29.9 bits (64), Expect = 0.51
 Identities = 24/67 (35%), Positives = 37/67 (55%), Gaps = 2/67 (2%)
 Frame = -2

Query: 389 PIASAVSLLTSSPFPQNLASSSMPSSCMTVESTSKQTQSAVLNN--SGQSVGATSR*STP 216
           PI+S+++   SS    +++SSS  SS  ++ S   +T SA  N+  SG S   TS  S+ 
Sbjct: 166 PISSSITSSISSSASSSVSSSS-ASSSGSISSADAKTVSASSNSTISGFSTSTTSASSSA 224

Query: 215 VRASSTS 195
              SS+S
Sbjct: 225 AGNSSSS 231


>SPAPB18E9.04c |||sequence orphan|Schizosaccharomyces pombe|chr
           1|||Manual
          Length = 800

 Score = 29.5 bits (63), Expect = 0.67
 Identities = 19/69 (27%), Positives = 37/69 (53%)
 Frame = -2

Query: 392 PPIASAVSLLTSSPFPQNLASSSMPSSCMTVESTSKQTQSAVLNNSGQSVGATSR*STPV 213
           PP  S  S  T+S F  + + SS+P++   V++ S  + + +   S  S  ++S   TP 
Sbjct: 693 PPTTSFPSTFTTS-FITSSSLSSIPNNSTEVKTASTSSGTEIKTASTSSGSSSSSSYTPA 751

Query: 212 RASSTSRTA 186
            ++ST+ ++
Sbjct: 752 SSTSTTTSS 760



 Score = 26.2 bits (55), Expect = 6.2
 Identities = 27/98 (27%), Positives = 46/98 (46%)
 Frame = -2

Query: 482 GNFSMNSLI*PTLGLMMSSLFFKASWNVILPPIASAVSLLTSSPFPQNLASSSMPSSCMT 303
           G+ S+++ I PT+    +S     S ++ +PP +++ +   SSP P    S +  +S  T
Sbjct: 183 GSSSLSTPITPTVPPTSTS-----STSIPIPPTSTSSTDTNSSPLPTTSTSCTTSTSIPT 237

Query: 302 VESTSKQTQSAVLNNSGQSVGATSR*STPVRASSTSRT 189
             S+S  T             +TS  S P+  +STS T
Sbjct: 238 GGSSSLSTPI----TPTVPPTSTSSTSIPIPPTSTSST 271



 Score = 25.8 bits (54), Expect = 8.2
 Identities = 24/99 (24%), Positives = 43/99 (43%)
 Frame = -2

Query: 482 GNFSMNSLI*PTLGLMMSSLFFKASWNVILPPIASAVSLLTSSPFPQNLASSSMPSSCMT 303
           G+ S+++ I PT+    +S     S ++ +PP +++ +   SSP P    S +  +S   
Sbjct: 239 GSSSLSTPITPTVPPTSTS-----STSIPIPPTSTSSTDTNSSPLPTTSTSCTTSTS--- 290

Query: 302 VESTSKQTQSAVLNNSGQSVGATSR*STPVRASSTSRTA 186
           +  T   T          S  +TS    P   SST  ++
Sbjct: 291 IPPTGNSTTPVTPTVPPTSTSSTSTPPPPASTSSTGTSS 329



 Score = 25.8 bits (54), Expect = 8.2
 Identities = 22/67 (32%), Positives = 31/67 (46%)
 Frame = -2

Query: 431 SSLFFKASWNVILPPIASAVSLLTSSPFPQNLASSSMPSSCMTVESTSKQTQSAVLNNSG 252
           SS   + SWN   P   ++ S +TSS     L S++  S+  T  STS  T S+    S 
Sbjct: 611 SSSSTQVSWNSTTPITGTSTSKVTSST-SIPLTSTNRTSTTFT-SSTSISTSSSSTATSS 668

Query: 251 QSVGATS 231
            S  + S
Sbjct: 669 TSFASES 675


>SPAPB15E9.01c ||SPAPB18E9.06c|sequence orphan|Schizosaccharomyces
           pombe|chr 1|||Manual
          Length = 1036

 Score = 29.1 bits (62), Expect = 0.88
 Identities = 21/72 (29%), Positives = 39/72 (54%), Gaps = 1/72 (1%)
 Frame = -2

Query: 383 ASAVSLLTSSPFPQNL-ASSSMPSSCMTVESTSKQTQSAVLNNSGQSVGATSR*STPVRA 207
           AS+ SL +SS    +L +SSS+ SS     +++  T S++ ++S  S    S  +T    
Sbjct: 70  ASSSSLTSSSAASSSLTSSSSLASSSTNSTTSASPTSSSLTSSSATSSSLASSSTTSSSL 129

Query: 206 SSTSRTAGCFSN 171
           +S+S T+   ++
Sbjct: 130 ASSSITSSSLAS 141



 Score = 28.7 bits (61), Expect = 1.2
 Identities = 22/67 (32%), Positives = 35/67 (52%), Gaps = 1/67 (1%)
 Frame = -2

Query: 383 ASAVSLLTSSPFPQNLASSSMPSSCMTVESTSKQTQSAVLNNSGQSVGATSR*STPVRA- 207
           AS+  L + S      A+S+  +   +V ST+  + S+    S  S  ATS  STP+ + 
Sbjct: 319 ASSTPLSSVSSANSTTATSTSSTPLSSVNSTTATSASSTPLTSVNSTTATSASSTPLTSV 378

Query: 206 SSTSRTA 186
           +STS T+
Sbjct: 379 NSTSATS 385



 Score = 28.3 bits (60), Expect = 1.5
 Identities = 22/67 (32%), Positives = 36/67 (53%), Gaps = 1/67 (1%)
 Frame = -2

Query: 383 ASAVSLLTSSPFPQNLASSSMPSSCMTVESTSKQTQSAVLNNSGQSVGATSR*STPVRA- 207
           AS+  L + +      ASS+  SS  +  ST+  + S+   +S  S  ATS  STP+ + 
Sbjct: 303 ASSTPLTSVNSTTTTSASSTPLSSVSSANSTTATSTSSTPLSSVNSTTATSASSTPLTSV 362

Query: 206 SSTSRTA 186
           +ST+ T+
Sbjct: 363 NSTTATS 369



 Score = 27.9 bits (59), Expect = 2.0
 Identities = 21/67 (31%), Positives = 34/67 (50%), Gaps = 1/67 (1%)
 Frame = -2

Query: 383 ASAVSLLTSSPFPQNLASSSMPSSCMTVESTSKQTQSAVLNNSGQSVGATSR*STPV-RA 207
           A++ S    S      A+S+  +   +V ST+  + S+    S  S  ATS  STP+  A
Sbjct: 335 ATSTSSTPLSSVNSTTATSASSTPLTSVNSTTATSASSTPLTSVNSTSATSASSTPLTSA 394

Query: 206 SSTSRTA 186
           +ST+ T+
Sbjct: 395 NSTTSTS 401



 Score = 27.9 bits (59), Expect = 2.0
 Identities = 23/72 (31%), Positives = 41/72 (56%), Gaps = 1/72 (1%)
 Frame = -2

Query: 398 ILPPIASAVSLLTSSPFPQNLASSSMPSSCMTVESTSKQTQSAVLNNSGQSVGATSR*ST 219
           +LP  + + + L+S+      ++SS P S  +V ST+  + S+   +S  S  ATS  ST
Sbjct: 414 VLPTSSVSSTPLSSANSTTATSASSTPLS--SVNSTTATSASSTPLSSVNSTTATSASST 471

Query: 218 PVRA-SSTSRTA 186
           P+ + +ST+ T+
Sbjct: 472 PLTSVNSTTATS 483



 Score = 27.9 bits (59), Expect = 2.0
 Identities = 21/67 (31%), Positives = 34/67 (50%), Gaps = 1/67 (1%)
 Frame = -2

Query: 383 ASAVSLLTSSPFPQNLASSSMPSSCMTVESTSKQTQSAVLNNSGQSVGATSR*STPV-RA 207
           A++ S    S      A+S+  +   +V ST+  + S+    S  S  ATS  STP+  A
Sbjct: 449 ATSASSTPLSSVNSTTATSASSTPLTSVNSTTATSASSTPLTSVNSTSATSASSTPLTSA 508

Query: 206 SSTSRTA 186
           +ST+ T+
Sbjct: 509 NSTTSTS 515



 Score = 27.5 bits (58), Expect = 2.7
 Identities = 24/67 (35%), Positives = 37/67 (55%), Gaps = 1/67 (1%)
 Frame = -2

Query: 383 ASAVSLLTSSPFPQNLASSSMPSSCMTVESTSKQTQSAVLNNSGQSVGATSR*STPVRA- 207
           ++A S  TSS  P +  SS+  SS     ST+  + S+   +S  S  ATS  STP+ + 
Sbjct: 404 STAPSYNTSSVLPTSSVSSTPLSSA---NSTTATSASSTPLSSVNSTTATSASSTPLSSV 460

Query: 206 SSTSRTA 186
           +ST+ T+
Sbjct: 461 NSTTATS 467



 Score = 27.1 bits (57), Expect = 3.6
 Identities = 19/66 (28%), Positives = 37/66 (56%)
 Frame = -2

Query: 383 ASAVSLLTSSPFPQNLASSSMPSSCMTVESTSKQTQSAVLNNSGQSVGATSR*STPVRAS 204
           +S  S  ++SP   +L SSS  SS +   ST+  +  A  + +  S+ ++S  S+ + +S
Sbjct: 94  SSTNSTTSASPTSSSLTSSSATSSSLASSSTT-SSSLASSSITSSSLASSSITSSSLASS 152

Query: 203 STSRTA 186
           ST+ ++
Sbjct: 153 STTSSS 158



 Score = 27.1 bits (57), Expect = 3.6
 Identities = 34/112 (30%), Positives = 48/112 (42%), Gaps = 6/112 (5%)
 Frame = -2

Query: 491 SLTGNFSMNSLI*PTLGLMMSSLFFKASWNVILPPIASAVSL---LTSSPFPQNLASSSM 321
           SL+   + NS    +  L  SSL    S       I+S VS    LTSS       S+S 
Sbjct: 212 SLSSTAASNSAT--SSSLASSSLNSTTSATATSSSISSTVSSSTPLTSSNSTTAATSASA 269

Query: 320 PSSCMTVESTS---KQTQSAVLNNSGQSVGATSR*STPVRASSTSRTAGCFS 174
            SS     ++S     T S+   +S  S  ATS  STP+ + +++ T    S
Sbjct: 270 TSSSAQYNTSSLLPSSTPSSTPLSSANSTTATSASSTPLTSVNSTTTTSASS 321



 Score = 27.1 bits (57), Expect = 3.6
 Identities = 21/67 (31%), Positives = 34/67 (50%), Gaps = 1/67 (1%)
 Frame = -2

Query: 383 ASAVSLLTSSPFPQNLASSSMPSSCMTVESTSKQTQSAVLNNSGQSVGATSR*STPVRA- 207
           A++ S    S      A+S+  +   +V ST+  + S+    S  S  ATS  STP+ + 
Sbjct: 433 ATSASSTPLSSVNSTTATSASSTPLSSVNSTTATSASSTPLTSVNSTTATSASSTPLTSV 492

Query: 206 SSTSRTA 186
           +STS T+
Sbjct: 493 NSTSATS 499



 Score = 27.1 bits (57), Expect = 3.6
 Identities = 27/75 (36%), Positives = 36/75 (48%), Gaps = 4/75 (5%)
 Frame = -2

Query: 383 ASAVSLLTSSPFPQNLASSSMPSSCMTVESTSKQTQSAVLNNSGQSVGATSR*STP---- 216
           ++A S  TSS  P +  SS+  SS     ST+  + S+    S  S  ATS  STP    
Sbjct: 518 STAPSYNTSSVLPTSSVSSTPLSSA---NSTTATSASSTPLTSVNSTTATSASSTPFGNS 574

Query: 215 VRASSTSRTAGCFSN 171
              SS S + G F+N
Sbjct: 575 TITSSASGSTGEFTN 589



 Score = 26.2 bits (55), Expect = 6.2
 Identities = 21/84 (25%), Positives = 41/84 (48%), Gaps = 1/84 (1%)
 Frame = -2

Query: 419 FKASWNVILPPIASAVSLLTSSPFPQNLASSSMPSSCMTVEST-SKQTQSAVLNNSGQSV 243
           + +S   +L    ++ +  TSS    +L SSS  SS +T  S+ +  + ++  + S  S 
Sbjct: 48  YLSSVPTLLKRATTSYNYNTSSASSSSLTSSSAASSSLTSSSSLASSSTNSTTSASPTSS 107

Query: 242 GATSR*STPVRASSTSRTAGCFSN 171
             TS  +T    +S+S T+   ++
Sbjct: 108 SLTSSSATSSSLASSSTTSSSLAS 131



 Score = 26.2 bits (55), Expect = 6.2
 Identities = 27/89 (30%), Positives = 41/89 (46%)
 Frame = -2

Query: 452 PTLGLMMSSLFFKASWNVILPPIASAVSLLTSSPFPQNLASSSMPSSCMTVESTSKQTQS 273
           PT     SSL   A+ N       ++ SL  +S       SSS+ S+  +  +TS    S
Sbjct: 172 PTSSATSSSLSSTAASNSATSSSLASSSL--NSTTSATATSSSLSSTAASNSATSSSLAS 229

Query: 272 AVLNNSGQSVGATSR*STPVRASSTSRTA 186
           + LN++  S  ATS   +   +SST  T+
Sbjct: 230 SSLNST-TSATATSSSISSTVSSSTPLTS 257


>SPAC7D4.11c |sec39||secretory pathway protein Sec39
           |Schizosaccharomyces pombe|chr 1|||Manual
          Length = 769

 Score = 28.7 bits (61), Expect = 1.2
 Identities = 15/49 (30%), Positives = 24/49 (48%)
 Frame = -2

Query: 398 ILPPIASAVSLLTSSPFPQNLASSSMPSSCMTVESTSKQTQSAVLNNSG 252
           +L  I  A++LLT    P     +S+  SC   +S  K  ++ +LN  G
Sbjct: 334 LLMEITKAIALLTQLKVPAPTFKTSVSISCSNFDSQIKYLENVLLNALG 382


>SPBC21D10.06c |map4||cell agglutination protein
           Map4|Schizosaccharomyces pombe|chr 2|||Manual
          Length = 948

 Score = 28.7 bits (61), Expect = 1.2
 Identities = 25/85 (29%), Positives = 42/85 (49%)
 Frame = -2

Query: 449 TLGLMMSSLFFKASWNVILPPIASAVSLLTSSPFPQNLASSSMPSSCMTVESTSKQTQSA 270
           T+ +  S+  +  S N    PI  + SL   S FP  + SSS   S ++   T+   QS+
Sbjct: 507 TVSVPSSTQSYSTSSN-FTTPITISTSL---SSFPTTIVSSSFQYSSLSSNVTTTNAQSS 562

Query: 269 VLNNSGQSVGATSR*STPVRASSTS 195
            L++S  S  A +  S+ + +S +S
Sbjct: 563 SLSSSNSS--ALTHISSSIVSSGSS 585



 Score = 27.5 bits (58), Expect = 2.7
 Identities = 17/52 (32%), Positives = 32/52 (61%), Gaps = 1/52 (1%)
 Frame = -2

Query: 338 LASSSMPSSCMTVESTSKQTQSAVLNNSGQSVGATS-R*STPVRASSTSRTA 186
           L SSS+ ++    EST  +T+S+  +   Q++ ++S   STPV  +S+S ++
Sbjct: 237 LESSSLTNTVSPTESTFYETKSSTSSVPTQTIDSSSFTSSTPVSLTSSSTSS 288


>SPAC4F10.02 |||aminopeptidase |Schizosaccharomyces pombe|chr
           1|||Manual
          Length = 467

 Score = 28.3 bits (60), Expect = 1.5
 Identities = 14/39 (35%), Positives = 20/39 (51%)
 Frame = -3

Query: 760 TITRRWYPCNSFSRLTTKXXPPDLDVGSFSSKPAYSPLK 644
           +I ++W P N FS + T    P L +   S K AY  L+
Sbjct: 70  SIGKKWKPGNGFSIIATHTDSPTLRLKPKSQKSAYGYLQ 108


>SPAC11G7.01 |||sequence orphan|Schizosaccharomyces pombe|chr
           1|||Manual
          Length = 536

 Score = 27.9 bits (59), Expect = 2.0
 Identities = 15/47 (31%), Positives = 32/47 (68%)
 Frame = -2

Query: 335 ASSSMPSSCMTVESTSKQTQSAVLNNSGQSVGATSR*STPVRASSTS 195
           ASSS+P+S  +  +++  + S+V+ +S  S+ ++S  +T + +SS+S
Sbjct: 18  ASSSIPASSSSAAASTSLSSSSVIPSSSSSMLSSSS-ATAISSSSSS 63


>SPCC757.12 |||alpha-amylase homolog |Schizosaccharomyces pombe|chr
           3|||Manual
          Length = 625

 Score = 27.9 bits (59), Expect = 2.0
 Identities = 21/66 (31%), Positives = 35/66 (53%)
 Frame = -2

Query: 383 ASAVSLLTSSPFPQNLASSSMPSSCMTVESTSKQTQSAVLNNSGQSVGATSR*STPVRAS 204
           AS  S+ TSS    + +SSS  S   +  S+S ++ S   + S  ++ +TS+ S     S
Sbjct: 517 ASLSSVHTSSATSSSKSSSSSSSRSGSSSSSSSRSGSTSSSGSSHTITSTSQ-SVHTSGS 575

Query: 203 STSRTA 186
           STS ++
Sbjct: 576 STSTSS 581


>SPAC2E1P3.05c |||fungal cellulose binding domain
           protein|Schizosaccharomyces pombe|chr 1|||Manual
          Length = 197

 Score = 27.5 bits (58), Expect = 2.7
 Identities = 19/68 (27%), Positives = 35/68 (51%)
 Frame = -2

Query: 386 IASAVSLLTSSPFPQNLASSSMPSSCMTVESTSKQTQSAVLNNSGQSVGATSR*STPVRA 207
           + S+ +L +SSP   + +++S+PS   T+ S+   +    L++SG S   +S  +T    
Sbjct: 130 LVSSTTLTSSSPSAVS-STTSIPSISSTISSSVSTSSFTSLSSSGFSTVLSSTNTTSALP 188

Query: 206 SSTSRTAG 183
           SS     G
Sbjct: 189 SSGWNVTG 196


>SPAC1834.11c |sec18||secretory pathway protein Sec18
           |Schizosaccharomyces pombe|chr 1|||Manual
          Length = 792

 Score = 27.5 bits (58), Expect = 2.7
 Identities = 11/30 (36%), Positives = 14/30 (46%)
 Frame = -1

Query: 840 NQGXPPKPMKPSAGGXKPRASVAPVPGRSP 751
           N+G P +PM+    G     S  P P  SP
Sbjct: 12  NKGTPEQPMRKPLSGSYSHNSAGPTPNMSP 41


>SPAC16C9.02c |||S-methyl-5-thioadenosine
           phosphorylase|Schizosaccharomyces pombe|chr 1|||Manual
          Length = 307

 Score = 27.1 bits (57), Expect = 3.6
 Identities = 13/37 (35%), Positives = 21/37 (56%)
 Frame = -3

Query: 664 PAYSPLK*NLSRLAKMLIVGMFSLSATGSIRLLNPPE 554
           P   P + N++ L  + ++ + S SA GS+R   PPE
Sbjct: 68  PTEVPSRANIAALKSLGVLAIVSFSAVGSLREDIPPE 104


>SPBC23G7.08c |rga7||GTPase activating protein
           Rga7|Schizosaccharomyces pombe|chr 2|||Manual
          Length = 695

 Score = 26.6 bits (56), Expect = 4.7
 Identities = 16/60 (26%), Positives = 31/60 (51%), Gaps = 2/60 (3%)
 Frame = -2

Query: 365 LTSSPFPQNLAS--SSMPSSCMTVESTSKQTQSAVLNNSGQSVGATSR*STPVRASSTSR 192
           + S  FP +  S  S+ P+S   + ST K + +   N S  S  +  R S+P+ +++ ++
Sbjct: 382 VASPAFPNSSTSNPSTAPASASPLASTLKPSTANDTNGSSSSSSSNPRTSSPLASNAENK 441


>SPCC18.01c |adg3|SPCC74.07c|beta-glucosidase Adg3
            |Schizosaccharomyces pombe|chr 3|||Manual
          Length = 1131

 Score = 26.6 bits (56), Expect = 4.7
 Identities = 25/81 (30%), Positives = 37/81 (45%), Gaps = 4/81 (4%)
 Frame = -2

Query: 386  IASAVSLLTSSPFPQNLASSS-MPSSCMTVESTSKQTQSAVLNNSGQSVGATSR*ST--- 219
            IAS+ S  T S  P+  +SSS +  S  ++ + S   +     +S  + G TS  ST   
Sbjct: 943  IASSASSNTLSTEPKTFSSSSTLSESISSINTNSLTVKPESSLSSSTTSGLTSSSSTIPS 1002

Query: 218  PVRASSTSRTAGCFSNCKEPS 156
              R+ S S +A   S  K  S
Sbjct: 1003 STRSESNSESASTSSASKRSS 1023


>SPAC17A5.07c |ulp2||SUMO deconjugating cysteine peptidase Ulp2
           |Schizosaccharomyces pombe|chr 1|||Manual
          Length = 652

 Score = 26.2 bits (55), Expect = 6.2
 Identities = 14/39 (35%), Positives = 19/39 (48%)
 Frame = -2

Query: 362 TSSPFPQNLASSSMPSSCMTVESTSKQTQSAVLNNSGQS 246
           TSSP    +   S+PSS     S S  +  + + NS QS
Sbjct: 263 TSSPHSSKMPKHSLPSSPTPFNSNSGDSLLSRIKNSNQS 301


>SPBP23A10.11c |||conserved fungal protein|Schizosaccharomyces
           pombe|chr 2|||Manual
          Length = 507

 Score = 25.8 bits (54), Expect = 8.2
 Identities = 22/64 (34%), Positives = 31/64 (48%)
 Frame = -2

Query: 386 IASAVSLLTSSPFPQNLASSSMPSSCMTVESTSKQTQSAVLNNSGQSVGATSR*STPVRA 207
           ++S  SL  SS    NLA+S  P++     ++S  T SA    S     ATS  ST + +
Sbjct: 166 LSSLASL--SSASTDNLAASVTPTTVAASVASSVDTDSASATISSVVDSATSSVSTVIPS 223

Query: 206 SSTS 195
           S  S
Sbjct: 224 SIIS 227


>SPAC22A12.09c |sap114||splicing factor Sap114|Schizosaccharomyces
           pombe|chr 1|||Manual
          Length = 481

 Score = 25.8 bits (54), Expect = 8.2
 Identities = 13/40 (32%), Positives = 15/40 (37%)
 Frame = -1

Query: 828 PPKPMKPSAGGXKPRASVAPVPGRSPGAGTRAIXSVVSPL 709
           PP    P  GG     SV+P    SP   T     V  P+
Sbjct: 334 PPSLASPEKGGISSTTSVSPAAQASPVLSTTTQPKVQKPV 373


>SPBC1921.03c |mex67||mRNA export receptor Mex67|Schizosaccharomyces
           pombe|chr 2|||Manual
          Length = 596

 Score = 25.8 bits (54), Expect = 8.2
 Identities = 9/25 (36%), Positives = 16/25 (64%), Gaps = 2/25 (8%)
 Frame = -2

Query: 407 WNVILPPIASAVSLLTSSPF--PQN 339
           WN++LP + +A+ ++    F  PQN
Sbjct: 445 WNLVLPSVGAAIKIVVHGQFEEPQN 469


  Database: spombe
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 2,362,478
  Number of sequences in database:  5004
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 3,342,539
Number of Sequences: 5004
Number of extensions: 66880
Number of successful extensions: 319
Number of sequences better than 10.0: 22
Number of HSP's better than 10.0 without gapping: 234
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 310
length of database: 2,362,478
effective HSP length: 72
effective length of database: 2,002,190
effective search space used: 446488370
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -