SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= psV30160.Seq
         (904 letters)

Database: spombe 
           5004 sequences; 2,362,478 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SPCC14G10.04 |||sequence orphan|Schizosaccharomyces pombe|chr 3|...    29   1.2  
SPBC1A4.01 |apc10|SPBC1E8.06|anaphase-promoting complex subunit ...    27   3.6  
SPBC31E1.06 |bms1|SPBC800.01|GTP binding protein Bms1|Schizosacc...    27   3.6  

>SPCC14G10.04 |||sequence orphan|Schizosaccharomyces pombe|chr
           3|||Manual
          Length = 497

 Score = 28.7 bits (61), Expect = 1.2
 Identities = 13/31 (41%), Positives = 15/31 (48%)
 Frame = -1

Query: 853 GPNAFPTKPPNXSXVFPPRLVNTXVFEXPVP 761
           GP    T  PN S    PR+ NT V   P+P
Sbjct: 294 GPETSKTSTPNMSNNPSPRVANTVVSPAPIP 324


>SPBC1A4.01 |apc10|SPBC1E8.06|anaphase-promoting complex subunit
           Apc10|Schizosaccharomyces pombe|chr 2|||Manual
          Length = 189

 Score = 27.1 bits (57), Expect = 3.6
 Identities = 11/41 (26%), Positives = 24/41 (58%)
 Frame = -2

Query: 297 DNERTARLDVEFLELRSNSSHDSHRINHVRRIRDFYADLRE 175
           D  R   LDV  ++++  ++H S + +HVR I+ +  ++ +
Sbjct: 127 DFGRNGLLDVHLIQIKILANHQSGKDSHVRLIKIYAPEIEQ 167


>SPBC31E1.06 |bms1|SPBC800.01|GTP binding protein
            Bms1|Schizosaccharomyces pombe|chr 2|||Manual
          Length = 1121

 Score = 27.1 bits (57), Expect = 3.6
 Identities = 10/19 (52%), Positives = 14/19 (73%)
 Frame = +3

Query: 84   VINWDETKWNGMRWTHNVR 140
            ++  D+T+WNGMR T  VR
Sbjct: 959  LLETDKTEWNGMRLTGEVR 977


  Database: spombe
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 2,362,478
  Number of sequences in database:  5004
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 3,440,787
Number of Sequences: 5004
Number of extensions: 66379
Number of successful extensions: 163
Number of sequences better than 10.0: 3
Number of HSP's better than 10.0 without gapping: 157
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 163
length of database: 2,362,478
effective HSP length: 72
effective length of database: 2,002,190
effective search space used: 456499320
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -