SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= psV30158.Seq
         (813 letters)

Database: spombe 
           5004 sequences; 2,362,478 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SPAC222.09 |seb1||RNA-binding protein Seb1 |Schizosaccharomyces ...    28   1.8  
SPAC821.13c ||SPAC955.01c|P-type ATPase |Schizosaccharomyces pom...    28   1.8  
SPCC548.07c |ght1||hexose transporter Ght1 |Schizosaccharomyces ...    27   3.2  
SPAC1F7.09c |||allantoicase |Schizosaccharomyces pombe|chr 1|||M...    25   9.7  
SPAC11E3.10 |||VanZ-like family protein|Schizosaccharomyces pomb...    25   9.7  

>SPAC222.09 |seb1||RNA-binding protein Seb1 |Schizosaccharomyces
           pombe|chr 1|||Manual
          Length = 620

 Score = 27.9 bits (59), Expect = 1.8
 Identities = 11/28 (39%), Positives = 15/28 (53%)
 Frame = -1

Query: 663 RRTASGSDWVTRTKLIPFPSNPWITGLP 580
           R   SG+DW      +P P+NP+  G P
Sbjct: 574 RHFDSGNDWHGNPSTVPPPTNPYNPGYP 601


>SPAC821.13c ||SPAC955.01c|P-type ATPase |Schizosaccharomyces
            pombe|chr 1|||Manual
          Length = 1562

 Score = 27.9 bits (59), Expect = 1.8
 Identities = 9/22 (40%), Positives = 18/22 (81%)
 Frame = +1

Query: 136  RYITLLSLIVLAVTLIFWWIFS 201
            +YI ++S+IVL +T + W++F+
Sbjct: 1440 QYINIISIIVLVLTSLAWFLFN 1461


>SPCC548.07c |ght1||hexose transporter Ght1 |Schizosaccharomyces
           pombe|chr 3|||Manual
          Length = 557

 Score = 27.1 bits (57), Expect = 3.2
 Identities = 12/35 (34%), Positives = 19/35 (54%)
 Frame = -2

Query: 323 IFFHXSKSLXVLXVSEXYKXQSXPESDRPINNTEL 219
           +F H SK L +  ++E Y   + P   RP N +E+
Sbjct: 450 LFAHESKGLTLEEINELYLSDAKPWMSRPKNLSEM 484


>SPAC1F7.09c |||allantoicase |Schizosaccharomyces pombe|chr
           1|||Manual
          Length = 342

 Score = 25.4 bits (53), Expect = 9.7
 Identities = 10/19 (52%), Positives = 11/19 (57%)
 Frame = -1

Query: 618 IPFPSNPWITGLPLAKAGP 562
           IP P   W+T LP  K GP
Sbjct: 283 IPGPDAQWVTILPARKLGP 301


>SPAC11E3.10 |||VanZ-like family protein|Schizosaccharomyces
           pombe|chr 1|||Manual
          Length = 162

 Score = 25.4 bits (53), Expect = 9.7
 Identities = 10/30 (33%), Positives = 20/30 (66%), Gaps = 2/30 (6%)
 Frame = +1

Query: 160 IVLAVTLIFWWIF--SRRYTLRNSVLLMGL 243
           +   +TL+F+W+F  SRR   + ++L+ G+
Sbjct: 48  VFFLLTLVFYWVFDLSRRRATQLTILVCGV 77


  Database: spombe
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 2,362,478
  Number of sequences in database:  5004
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 2,809,155
Number of Sequences: 5004
Number of extensions: 49111
Number of successful extensions: 113
Number of sequences better than 10.0: 5
Number of HSP's better than 10.0 without gapping: 111
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 113
length of database: 2,362,478
effective HSP length: 72
effective length of database: 2,002,190
effective search space used: 396433620
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -