SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= psV30155.Seq
         (883 letters)

Database: spombe 
           5004 sequences; 2,362,478 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SPAC1786.02 |||phospholipase |Schizosaccharomyces pombe|chr 1|||...    32   0.12 
SPBC1685.15c |klp6|sot2, SPBC649.01c|kinesin-like protein Klp6|S...    29   1.2  
SPAC17A5.11 |rec12|spo11|endonuclease Rec12|Schizosaccharomyces ...    28   1.5  
SPAC3A12.02 |||inorganic pyrophosphatase|Schizosaccharomyces pom...    27   4.7  
SPBC13E7.08c |||RNA polymerase II associated Paf1 complex |Schiz...    26   6.2  
SPBC1709.01 |chs2|SPBC1734.17|chitin synthase homolog Chs2|Schiz...    26   8.2  

>SPAC1786.02 |||phospholipase |Schizosaccharomyces pombe|chr
           1|||Manual
          Length = 644

 Score = 31.9 bits (69), Expect = 0.12
 Identities = 10/30 (33%), Positives = 16/30 (53%)
 Frame = +3

Query: 402 FWGRGAVKH*IGTLKGAPDLELDGESRRTW 491
           +WGR   +H +G L+G P+L        +W
Sbjct: 227 YWGRAIARHFVGQLRGGPNLTYSSVQNASW 256


>SPBC1685.15c |klp6|sot2, SPBC649.01c|kinesin-like protein
           Klp6|Schizosaccharomyces pombe|chr 2|||Manual
          Length = 784

 Score = 28.7 bits (61), Expect = 1.2
 Identities = 16/53 (30%), Positives = 26/53 (49%), Gaps = 2/53 (3%)
 Frame = +1

Query: 223 NRPKSAKSLINKRIDRDRVECCSSLEQESTIKERGLQRQRAKNRL--SGRWPT 375
           ++PK  KSL    ++ DR     S +  +++    L    AKN+   S +WPT
Sbjct: 695 SKPKVEKSLDKHNMNNDRSFLVPSRDARNSLTSLSLHSNVAKNKSSHSSKWPT 747


>SPAC17A5.11 |rec12|spo11|endonuclease Rec12|Schizosaccharomyces
           pombe|chr 1|||Manual
          Length = 345

 Score = 28.3 bits (60), Expect = 1.5
 Identities = 11/33 (33%), Positives = 17/33 (51%)
 Frame = -3

Query: 392 RVMVHVVGHRPDRRFFAL*RWSPRSLIVDSCSK 294
           + +V +    PD +FF +  W P  L + SC K
Sbjct: 210 KFLVKLAKALPDAKFFGIFDWDPHGLCIYSCFK 242


>SPAC3A12.02 |||inorganic pyrophosphatase|Schizosaccharomyces
           pombe|chr 1|||Manual
          Length = 286

 Score = 26.6 bits (56), Expect = 4.7
 Identities = 13/42 (30%), Positives = 23/42 (54%)
 Frame = -3

Query: 365 RPDRRFFAL*RWSPRSLIVDSCSKLEQHSTLSRSILLFIRDF 240
           +P  RFF    + P+S  +D  ++  QH  +SR    +I++F
Sbjct: 205 KPKNRFFFDGNYLPKSDALDIIAQCHQHWKVSRDRKQYIKNF 246


>SPBC13E7.08c |||RNA polymerase II associated Paf1 complex
           |Schizosaccharomyces pombe|chr 2|||Manual
          Length = 429

 Score = 26.2 bits (55), Expect = 6.2
 Identities = 13/41 (31%), Positives = 22/41 (53%)
 Frame = +1

Query: 229 PKSAKSLINKRIDRDRVECCSSLEQESTIKERGLQRQRAKN 351
           P+S  S  N+ ID DR++    ++QE   + RG  +   +N
Sbjct: 290 PRSTYSEQNEIIDSDRMDRLKRIKQEGAGQYRGYNKDLEEN 330


>SPBC1709.01 |chs2|SPBC1734.17|chitin synthase homolog
           Chs2|Schizosaccharomyces pombe|chr 2|||Manual
          Length = 926

 Score = 25.8 bits (54), Expect = 8.2
 Identities = 11/27 (40%), Positives = 13/27 (48%)
 Frame = -1

Query: 145 PFXCATVGKGDRCGPLRYYASWRKGDV 65
           P  C  V  G R GP   Y +W+  DV
Sbjct: 392 PKVCLFVRNGARLGPTSIYHAWKAFDV 418


  Database: spombe
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 2,362,478
  Number of sequences in database:  5004
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 3,505,288
Number of Sequences: 5004
Number of extensions: 71369
Number of successful extensions: 149
Number of sequences better than 10.0: 6
Number of HSP's better than 10.0 without gapping: 145
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 149
length of database: 2,362,478
effective HSP length: 72
effective length of database: 2,002,190
effective search space used: 442483990
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -