SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= psV30153.Seq
         (864 letters)

Database: spombe 
           5004 sequences; 2,362,478 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SPBC1A4.07c |||U3 snoRNP-associated protein Sof1|Schizosaccharom...    35   0.013
SPAC222.06 |mak16||nuclear HMG-like acidic protein Mak16|Schizos...    28   1.5  
SPBP35G2.06c |nup131|Nup133a|nucleoporin Nup131|Schizosaccharomy...    27   2.6  
SPAC2F7.15 |rsm24||mitochondrial ribosomal protein subunit S24|S...    26   6.0  
SPACUNK4.15 |||2',3'-cyclic-nucleotide 3'-phosphodiesterase |Sch...    26   7.9  

>SPBC1A4.07c |||U3 snoRNP-associated protein
           Sof1|Schizosaccharomyces pombe|chr 2|||Manual
          Length = 436

 Score = 35.1 bits (77), Expect = 0.013
 Identities = 24/95 (25%), Positives = 47/95 (49%), Gaps = 2/95 (2%)
 Frame = +3

Query: 87  NVKLWRLNSTSADSALKKGEEEEEFRVLDILKKRDK--MQRRVVKRTDVQPDRIDRMAQT 260
           NV+LWR  ++S  ++++   EE   + LD L++R K   + R + R    P  + + A+ 
Sbjct: 339 NVRLWRARASSR-ASIRSTREENRLKYLDSLRERYKHIPEIRRIARHRHLPTNVKKAAEI 397

Query: 261 RTGGMCGLVRKLSTRLRCHYRYVRATYQRVKHRQV 365
           +   +  L R+    +R H +     Y++ + R V
Sbjct: 398 KREEINSLKRR-EENIRRHSKKGAVPYEKERERHV 431


>SPAC222.06 |mak16||nuclear HMG-like acidic protein
           Mak16|Schizosaccharomyces pombe|chr 1|||Manual
          Length = 302

 Score = 28.3 bits (60), Expect = 1.5
 Identities = 14/41 (34%), Positives = 22/41 (53%), Gaps = 3/41 (7%)
 Frame = +3

Query: 45  LIKRSKSGCFNSA---CNVKLWRLNSTSADSALKKGEEEEE 158
           L+KR KSG +       N ++W     + +  + +GEEEEE
Sbjct: 165 LVKRLKSGVYGDQPLNVNEEIWNKVLAAREGLIDEGEEEEE 205


>SPBP35G2.06c |nup131|Nup133a|nucleoporin Nup131|Schizosaccharomyces
            pombe|chr 2|||Manual
          Length = 1142

 Score = 27.5 bits (58), Expect = 2.6
 Identities = 9/25 (36%), Positives = 16/25 (64%)
 Frame = +2

Query: 605  TSNSINMQQTSLRGWSVTGTTQKQI 679
            TSN +N+ + S+R W V+   ++ I
Sbjct: 955  TSNCVNLSENSIRAWLVSSAVERLI 979


>SPAC2F7.15 |rsm24||mitochondrial ribosomal protein subunit
           S24|Schizosaccharomyces pombe|chr 1|||Manual
          Length = 258

 Score = 26.2 bits (55), Expect = 6.0
 Identities = 21/56 (37%), Positives = 28/56 (50%)
 Frame = +1

Query: 529 SDYCHASPSIRNPLARVVILRVQLADLKLDKHATDKFKRLVGDRYDPKTDLVTIHS 696
           SD   +S    NP   VV  +V    L L++      + LVG RY+P+ DLV I S
Sbjct: 117 SDVQMSSFEKMNPKV-VVTFKVTNIPL-LEEKQRHVLRLLVGPRYNPEEDLVRISS 170


>SPACUNK4.15 |||2',3'-cyclic-nucleotide 3'-phosphodiesterase
           |Schizosaccharomyces pombe|chr 1|||Manual
          Length = 208

 Score = 25.8 bits (54), Expect = 7.9
 Identities = 9/28 (32%), Positives = 15/28 (53%)
 Frame = -1

Query: 684 H*ICFWVVPVTDQPLKLVCCMFIEFEVC 601
           H  C W+VP     ++L    F+++ VC
Sbjct: 27  HCYCVWLVPAISSDIELRYRTFVDWAVC 54


  Database: spombe
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 2,362,478
  Number of sequences in database:  5004
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 3,587,637
Number of Sequences: 5004
Number of extensions: 76434
Number of successful extensions: 186
Number of sequences better than 10.0: 5
Number of HSP's better than 10.0 without gapping: 181
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 186
length of database: 2,362,478
effective HSP length: 72
effective length of database: 2,002,190
effective search space used: 430470850
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -