SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= psV30149.Seq
         (867 letters)

Database: spombe 
           5004 sequences; 2,362,478 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SPAC3H8.08c |||transcription factor|Schizosaccharomyces pombe|ch...    27   3.5  
SPAC25H1.02 |jmj1||Jmj1 protein|Schizosaccharomyces pombe|chr 1|...    26   6.0  
SPBC14C8.17c |||SAGA complex subunit Spt8 |Schizosaccharomyces p...    26   6.0  
SPAC2G11.03c |vps45||vacuolar sorting protein Vps 45|Schizosacch...    26   8.0  
SPBC29A3.03c |||ubiquitin-protein ligase E3 |Schizosaccharomyces...    26   8.0  

>SPAC3H8.08c |||transcription factor|Schizosaccharomyces pombe|chr
           1|||Manual
          Length = 563

 Score = 27.1 bits (57), Expect = 3.5
 Identities = 21/72 (29%), Positives = 35/72 (48%), Gaps = 5/72 (6%)
 Frame = +2

Query: 560 PDQGQSKNALHNY--WKALDNHLRKWRTLSG--KQRVHFXXXXXXXXXKNXAL-SLSDLL 724
           PD    KN   ++  W++L   L K+R  S     R  F          N  + SL++LL
Sbjct: 78  PDINPKKNEKFDFYGWRSLFE-LIKYRKDSDMCSSRPSFSIQAYSSYKDNVVVESLANLL 136

Query: 725 PPHCVRERIISV 760
           PP C+ ++I+++
Sbjct: 137 PPFCISQKIVNL 148


>SPAC25H1.02 |jmj1||Jmj1 protein|Schizosaccharomyces pombe|chr
           1|||Manual
          Length = 464

 Score = 26.2 bits (55), Expect = 6.0
 Identities = 9/27 (33%), Positives = 14/27 (51%)
 Frame = +3

Query: 453 TRPWTILSSWLTTHSTPATSHSLAIPD 533
           T  W   ++W+T+   P   HS  +PD
Sbjct: 45  TAQWKANTTWITSKGDPNILHSYILPD 71


>SPBC14C8.17c |||SAGA complex subunit Spt8 |Schizosaccharomyces
           pombe|chr 2|||Manual
          Length = 526

 Score = 26.2 bits (55), Expect = 6.0
 Identities = 21/72 (29%), Positives = 27/72 (37%), Gaps = 2/72 (2%)
 Frame = -3

Query: 691 YTNPSDGSCEVYSLFPRQRSPFP*MVVQRLPIV--V*RVLALPLVWPPSDVSLTPSGIAK 518
           +T   DG    Y  FP         V QR P V  V +   L   W  +     PS +  
Sbjct: 134 FTGGEDGYIRKYDFFPSINGDLSLTVAQRHPFVDTVTKAGILLNYWENAYDGNKPSSVYS 193

Query: 517 LCDVAGVLWVVS 482
           L   +  LWV+S
Sbjct: 194 LAAHSRGLWVLS 205


>SPAC2G11.03c |vps45||vacuolar sorting protein Vps
           45|Schizosaccharomyces pombe|chr 1|||Manual
          Length = 558

 Score = 25.8 bits (54), Expect = 8.0
 Identities = 11/29 (37%), Positives = 18/29 (62%)
 Frame = +2

Query: 320 DIGQVLKAARLLCKPPQQVDFEDEQEMRF 406
           ++G+V ++  L+C  PQ  DF D Q + F
Sbjct: 349 EVGEVEQS--LVCNEPQSTDFNDIQRLLF 375


>SPBC29A3.03c |||ubiquitin-protein ligase E3 |Schizosaccharomyces
           pombe|chr 2|||Manual
          Length = 398

 Score = 25.8 bits (54), Expect = 8.0
 Identities = 17/58 (29%), Positives = 26/58 (44%), Gaps = 8/58 (13%)
 Frame = -1

Query: 843 EIFLPSNAIFLAL--------KRVNPNPXIMAXNGHTLIMRSLTQCGGNRSDNERAXF 694
           EIFLPS+  F ++        +    NP +M   GH ++  SL Q   N S   +  +
Sbjct: 326 EIFLPSSYHFHSVFTCPVSKEQATEENPPMMMSCGHVIVKESLRQLSRNGSQRFKCPY 383


  Database: spombe
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 2,362,478
  Number of sequences in database:  5004
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 3,398,227
Number of Sequences: 5004
Number of extensions: 68333
Number of successful extensions: 169
Number of sequences better than 10.0: 5
Number of HSP's better than 10.0 without gapping: 169
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 169
length of database: 2,362,478
effective HSP length: 72
effective length of database: 2,002,190
effective search space used: 432473040
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -