SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= psV30148.Seq
         (812 letters)

Database: spombe 
           5004 sequences; 2,362,478 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SPBPB7E8.01 |||sequence orphan|Schizosaccharomyces pombe|chr 2||...    28   1.8  
SPAC13G7.03 |||up-frameshift suppressor3 family|Schizosaccharomy...    27   2.4  
SPBC800.12c |||ubiquitin family protein, unknown|Schizosaccharom...    27   3.2  
SPCC285.16c |msh6||MutS protein homolog|Schizosaccharomyces pomb...    26   5.5  

>SPBPB7E8.01 |||sequence orphan|Schizosaccharomyces pombe|chr
           2|||Manual
          Length = 569

 Score = 27.9 bits (59), Expect = 1.8
 Identities = 10/17 (58%), Positives = 12/17 (70%)
 Frame = -2

Query: 607 FSCYFGSSCHSGACVCR 557
           FSCYFGS  HS   +C+
Sbjct: 108 FSCYFGSDGHSNDTLCQ 124


>SPAC13G7.03 |||up-frameshift suppressor3 family|Schizosaccharomyces
           pombe|chr 1|||Manual
          Length = 278

 Score = 27.5 bits (58), Expect = 2.4
 Identities = 14/42 (33%), Positives = 20/42 (47%)
 Frame = +2

Query: 662 LQRRKEIPASKGSSQPSKAGHNL*SRLPFFLKPXTTHSNSGK 787
           L  +K     KG S+PSK       +L    KP + +S +GK
Sbjct: 156 LAEKKNAVVEKGKSKPSKKSVKAKKKLRLAEKPASNNSKAGK 197


>SPBC800.12c |||ubiquitin family protein,
           unknown|Schizosaccharomyces pombe|chr 2|||Manual
          Length = 137

 Score = 27.1 bits (57), Expect = 3.2
 Identities = 13/31 (41%), Positives = 21/31 (67%)
 Frame = +2

Query: 620 PKQETTTKFN*RSGLQRRKEIPASKGSSQPS 712
           P Q+ +T+ N +S +   KE+ AS+ S+QPS
Sbjct: 68  PIQQASTEINVQSTILELKEVLASQLSTQPS 98


>SPCC285.16c |msh6||MutS protein homolog|Schizosaccharomyces
           pombe|chr 3|||Manual
          Length = 1254

 Score = 26.2 bits (55), Expect = 5.5
 Identities = 20/71 (28%), Positives = 36/71 (50%), Gaps = 9/71 (12%)
 Frame = +3

Query: 240 QRRPEQ-IFSKRNIDPEQIKEI------NNYYDIETTVTVEFDTGQAYRDFVAGPYFRNR 398
           Q RP++ I  K  I  + I+ I      ++ ++     T  +D  +  R+ +AG YF+N 
Sbjct: 551 QVRPKELILEKSKISQKSIRAIKYCVSSSSIWNFIKPYTEFWDNERVEREIIAGDYFKNG 610

Query: 399 IE--DQITESY 425
           +E   +I +SY
Sbjct: 611 LEGAPKILKSY 621


  Database: spombe
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 2,362,478
  Number of sequences in database:  5004
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 2,958,122
Number of Sequences: 5004
Number of extensions: 54643
Number of successful extensions: 147
Number of sequences better than 10.0: 4
Number of HSP's better than 10.0 without gapping: 145
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 147
length of database: 2,362,478
effective HSP length: 72
effective length of database: 2,002,190
effective search space used: 396433620
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -