SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= psV30147.Seq
         (878 letters)

Database: spombe 
           5004 sequences; 2,362,478 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SPCC794.09c |ef1a-a||translation elongation factor EF-1 alpha Ef...   247   1e-66
SPAC23A1.10 |ef1a-b||translation elongation factor EF-1 alpha Ef...   247   2e-66
SPBC839.15c |ef1a-c||translation elongation factor EF-1 alpha Ef...   247   2e-66
SPCC584.04 |sup35|erf3|translation release factor eRF3 |Schizosa...   111   1e-25
SPBC25B2.01 ||SPBC2G5.08|elongation factor 1 alpha related prote...   110   3e-25
SPBC9B6.04c |tuf1||mitochondrial translation elongation factor E...    73   5e-14
SPBC17G9.09 |tif213||translation initiation factor eIF2 gamma su...    37   0.003
SPCP31B10.07 |eft202||translation elongation factor 2 |Schizosac...    36   0.010
SPAC513.01c |eft201|eft2-1, etf2, SPAPYUK71.04c|translation elon...    36   0.010
SPBC1306.01c ||SPBC409.22c|translation elongation factor G|Schiz...    34   0.023
SPBC1271.15c |||translation initiation factor IF-2Mt|Schizosacch...    33   0.041
SPCC553.08c |||GTPase Ria1 |Schizosaccharomyces pombe|chr 3|||Ma...    31   0.22 
SPAC1B3.04c |||mitochondrial GTPase Guf1 |Schizosaccharomyces po...    31   0.29 
SPBC660.10 |||translation elongation factor G|Schizosaccharomyce...    30   0.50 
SPAC56F8.03 |||translation initiation factor IF2 |Schizosaccharo...    29   0.66 
SPBC215.12 |cwf10|spef2, snu114|GTPase Cwf10 |Schizosaccharomyce...    28   1.5  
SPAC1093.01 ||SPAC12B10.18|PPR repeat protein|Schizosaccharomyce...    27   2.7  
SPBC1703.06 |pof10||F-box protein Pof10|Schizosaccharomyces pomb...    27   4.7  
SPAC9G1.11c |spn4||septin Spn4|Schizosaccharomyces pombe|chr 1||...    26   6.1  
SPAPB1A10.07c |||sphingolipid biosynthesis protein|Schizosacchar...    26   6.1  

>SPCC794.09c |ef1a-a||translation elongation factor EF-1 alpha
           Ef1a-a |Schizosaccharomyces pombe|chr 3|||Manual
          Length = 460

 Score =  247 bits (605), Expect = 1e-66
 Identities = 117/195 (60%), Positives = 142/195 (72%)
 Frame = +1

Query: 256 IDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQ 435
           IDIALWKFET KY VT+IDAPGHRDFIKNMITGTSQADCAVLI+  GTGEFEAGISK+GQ
Sbjct: 73  IDIALWKFETPKYNVTVIDAPGHRDFIKNMITGTSQADCAVLIIGGGTGEFEAGISKDGQ 132

Query: 436 TREHALLAFTLGVKQLIVGVNKMDSLNHHTVSPDLRKSRRKYPHTSRRLGYNPAAVAFVP 615
           TREHALLA+TLGVKQLIV VNKMD+           +  ++  +  +++G+NP  V FVP
Sbjct: 133 TREHALLAYTLGVKQLIVAVNKMDTTGWSQAR--FEEIVKETSNFIKKVGFNPKTVPFVP 190

Query: 616 ISGWHGDNMLEPSTKMPWFKGWQVERKEGKADGKCLIEALDAILPPARPLTSPCVFPARR 795
           +SG+ GDNM+EP+T MPW++GWQ E K G   GK L+EA+D+I PPARP   P   P + 
Sbjct: 191 VSGFQGDNMIEPTTNMPWYQGWQKETKAGVVKGKTLLEAIDSIEPPARPTDKPLRLPLQD 250

Query: 796 IXNSVVXVPCPSGRI 840
           +         P GR+
Sbjct: 251 VYKIGGIGTVPVGRV 265



 Score =  141 bits (341), Expect = 1e-34
 Identities = 64/68 (94%), Positives = 66/68 (97%)
 Frame = +3

Query: 42  MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVL 221
           MGKEK HIN+VVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEA E+GKGSFKYAWVL
Sbjct: 1   MGKEKGHINVVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEATELGKGSFKYAWVL 60

Query: 222 DKLKAERE 245
           DKLKAERE
Sbjct: 61  DKLKAERE 68


>SPAC23A1.10 |ef1a-b||translation elongation factor EF-1 alpha
           Ef1a-b |Schizosaccharomyces pombe|chr 1|||Manual
          Length = 460

 Score =  247 bits (604), Expect = 2e-66
 Identities = 116/195 (59%), Positives = 142/195 (72%)
 Frame = +1

Query: 256 IDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQ 435
           IDIALWKFET KY VT+IDAPGHRDFIKNMITGTSQADCA+LI+  GTGEFEAGISK+GQ
Sbjct: 73  IDIALWKFETPKYNVTVIDAPGHRDFIKNMITGTSQADCAILIIGGGTGEFEAGISKDGQ 132

Query: 436 TREHALLAFTLGVKQLIVGVNKMDSLNHHTVSPDLRKSRRKYPHTSRRLGYNPAAVAFVP 615
           TREHALLA+TLGVKQLIV VNKMD+           +  ++  +  +++G+NP  V FVP
Sbjct: 133 TREHALLAYTLGVKQLIVAVNKMDTTGWSQAR--FEEIVKETSNFIKKVGFNPKTVPFVP 190

Query: 616 ISGWHGDNMLEPSTKMPWFKGWQVERKEGKADGKCLIEALDAILPPARPLTSPCVFPARR 795
           +SG+ GDNM+EP+T MPW++GWQ E K G   GK L+EA+D+I PPARP   P   P + 
Sbjct: 191 VSGFQGDNMIEPTTNMPWYQGWQKETKAGVVKGKTLLEAIDSIEPPARPTDKPLRLPLQD 250

Query: 796 IXNSVVXVPCPSGRI 840
           +         P GR+
Sbjct: 251 VYKIGGIGTVPVGRV 265



 Score =  141 bits (341), Expect = 1e-34
 Identities = 64/68 (94%), Positives = 66/68 (97%)
 Frame = +3

Query: 42  MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVL 221
           MGKEK HIN+VVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEA E+GKGSFKYAWVL
Sbjct: 1   MGKEKGHINVVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEATELGKGSFKYAWVL 60

Query: 222 DKLKAERE 245
           DKLKAERE
Sbjct: 61  DKLKAERE 68


>SPBC839.15c |ef1a-c||translation elongation factor EF-1 alpha
           Ef1a-c |Schizosaccharomyces pombe|chr 2|||Manual
          Length = 460

 Score =  247 bits (604), Expect = 2e-66
 Identities = 116/195 (59%), Positives = 142/195 (72%)
 Frame = +1

Query: 256 IDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQ 435
           IDIALWKFET KY VT+IDAPGHRDFIKNMITGTSQADCA+LI+  GTGEFEAGISK+GQ
Sbjct: 73  IDIALWKFETPKYNVTVIDAPGHRDFIKNMITGTSQADCAILIIGGGTGEFEAGISKDGQ 132

Query: 436 TREHALLAFTLGVKQLIVGVNKMDSLNHHTVSPDLRKSRRKYPHTSRRLGYNPAAVAFVP 615
           TREHALLA+TLGVKQLIV VNKMD+           +  ++  +  +++G+NP  V FVP
Sbjct: 133 TREHALLAYTLGVKQLIVAVNKMDTTGWSQAR--FEEIVKETSNFIKKVGFNPKTVPFVP 190

Query: 616 ISGWHGDNMLEPSTKMPWFKGWQVERKEGKADGKCLIEALDAILPPARPLTSPCVFPARR 795
           +SG+ GDNM+EP+T MPW++GWQ E K G   GK L+EA+D+I PPARP   P   P + 
Sbjct: 191 VSGFQGDNMIEPTTNMPWYQGWQKETKAGVVKGKTLLEAIDSIEPPARPTDKPLRLPLQD 250

Query: 796 IXNSVVXVPCPSGRI 840
           +         P GR+
Sbjct: 251 VYKIGGIGTVPVGRV 265



 Score =  141 bits (341), Expect = 1e-34
 Identities = 64/68 (94%), Positives = 66/68 (97%)
 Frame = +3

Query: 42  MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVL 221
           MGKEK HIN+VVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEA E+GKGSFKYAWVL
Sbjct: 1   MGKEKGHINVVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEATELGKGSFKYAWVL 60

Query: 222 DKLKAERE 245
           DKLKAERE
Sbjct: 61  DKLKAERE 68


>SPCC584.04 |sup35|erf3|translation release factor eRF3
           |Schizosaccharomyces pombe|chr 3|||Manual
          Length = 662

 Score =  111 bits (268), Expect = 1e-25
 Identities = 57/145 (39%), Positives = 87/145 (60%), Gaps = 4/145 (2%)
 Frame = +1

Query: 256 IDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQ 435
           +++    FET     +++DAPGH+ ++ NMI G SQAD  VL+++A  GEFEAG  + GQ
Sbjct: 304 VEVGRAYFETEHRRFSLLDAPGHKGYVTNMINGASQADIGVLVISARRGEFEAGFERGGQ 363

Query: 436 TREHALLAFTLGVKQLIVGVNKMDSLNHHTVSPDLRKSRRKYPHTSRRL-GYNPAA-VAF 609
           TREHA+LA T G+  L+V +NKMD  +        ++   K     RR+ GYN    V +
Sbjct: 364 TREHAVLARTQGINHLVVVINKMDEPSVQWSEERYKECVDKLSMFLRRVAGYNSKTDVKY 423

Query: 610 VPISGWHGDNMLE--PSTKMPWFKG 678
           +P+S + G N+ +   S+  PW++G
Sbjct: 424 MPVSAYTGQNVKDRVDSSVCPWYQG 448



 Score = 80.6 bits (190), Expect = 3e-16
 Identities = 35/64 (54%), Positives = 47/64 (73%)
 Frame = +3

Query: 54  KTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLK 233
           K H+NIV IGHVD+GKST  G++++  G +DKRT+EK E+EA+E GK S+  +W LD   
Sbjct: 236 KEHVNIVFIGHVDAGKSTLGGNILFLTGMVDKRTMEKIEREAKEAGKESWYLSWALDSTS 295

Query: 234 AERE 245
            ERE
Sbjct: 296 EERE 299


>SPBC25B2.01 ||SPBC2G5.08|elongation factor 1 alpha related
           protein|Schizosaccharomyces pombe|chr 2|||Manual
          Length = 592

 Score =  110 bits (264), Expect = 3e-25
 Identities = 67/177 (37%), Positives = 94/177 (53%), Gaps = 4/177 (2%)
 Frame = +1

Query: 256 IDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQ 435
           +D+A   FE+ K    I DAPGHRDFI  MI G S AD AVL+V +    FE G  +NGQ
Sbjct: 243 MDVASTTFESDKKIYEIGDAPGHRDFISGMIAGASSADFAVLVVDSSQNNFERGFLENGQ 302

Query: 436 TREHALLAFTLGVKQLIVGVNKMDSLNHHTVSPDLRKSRRKY--PHTSRRLGYNPAAVAF 609
           TREHA L   LG+ +++V VNK+D ++    S D  +  +        + +G+  + V F
Sbjct: 303 TREHAYLLRALGISEIVVSVNKLDLMSW---SEDRFQEIKNIVSDFLIKMVGFKTSNVHF 359

Query: 610 VPISGWHGDNML--EPSTKMPWFKGWQVERKEGKADGKCLIEALDAILPPARPLTSP 774
           VPIS   G N++  + S    W+K            G  L+ ALD ++PP +P   P
Sbjct: 360 VPISAISGTNLIQKDSSDLYKWYK------------GPTLLSALDQLVPPEKPYRKP 404



 Score = 72.5 bits (170), Expect = 7e-14
 Identities = 31/63 (49%), Positives = 44/63 (69%)
 Frame = +3

Query: 54  KTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLK 233
           K  +++VV GHVDSGKST  G ++++ G I+ R+++K   EA   GKGSF YAW+LD  +
Sbjct: 175 KPVVHLVVTGHVDSGKSTMLGRIMFELGEINSRSMQKLHNEAANSGKGSFSYAWLLDTTE 234

Query: 234 AER 242
            ER
Sbjct: 235 EER 237


>SPBC9B6.04c |tuf1||mitochondrial translation elongation factor
           EF-Tu Tuf1 |Schizosaccharomyces pombe|chr 2|||Manual
          Length = 439

 Score = 72.9 bits (171), Expect = 5e-14
 Identities = 35/78 (44%), Positives = 52/78 (66%)
 Frame = +1

Query: 274 KFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHAL 453
           ++ET+  +   +D PGH D+IKNMITG +  D A+++V+A  G+         QTREH L
Sbjct: 110 EYETANRHYAHVDCPGHADYIKNMITGAATMDGAIIVVSATDGQMP-------QTREHLL 162

Query: 454 LAFTLGVKQLIVGVNKMD 507
           LA  +GVKQ++V +NK+D
Sbjct: 163 LARQVGVKQIVVYINKVD 180



 Score = 35.1 bits (77), Expect = 0.013
 Identities = 16/29 (55%), Positives = 20/29 (68%)
 Frame = +3

Query: 48  KEKTHINIVVIGHVDSGKSTTTGHLIYKC 134
           ++K H+NI  IGHVD GK+T T   I KC
Sbjct: 49  RKKPHVNIGTIGHVDHGKTTLTA-AITKC 76


>SPBC17G9.09 |tif213||translation initiation factor eIF2 gamma
           subunit|Schizosaccharomyces pombe|chr 2|||Manual
          Length = 446

 Score = 37.1 bits (82), Expect = 0.003
 Identities = 20/71 (28%), Positives = 34/71 (47%)
 Frame = +1

Query: 295 YVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALLAFTLGV 474
           +V+ +D PGH   +  M+ G +  D A+L++A              QT EH      + +
Sbjct: 109 HVSFVDCPGHDILMATMLNGAAVMDAALLLIAGNES------CPQPQTSEHLAAIEIMQL 162

Query: 475 KQLIVGVNKMD 507
           K +I+  NK+D
Sbjct: 163 KHIIILQNKVD 173


>SPCP31B10.07 |eft202||translation elongation factor 2
           |Schizosaccharomyces pombe|chr 3|||Manual
          Length = 842

 Score = 35.5 bits (78), Expect = 0.010
 Identities = 17/32 (53%), Positives = 19/32 (59%)
 Frame = +3

Query: 42  MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCG 137
           MGK     N+ VI HVD GKST T  L+ K G
Sbjct: 13  MGKPSNVRNMSVIAHVDHGKSTLTDSLVQKAG 44



 Score = 27.9 bits (59), Expect = 2.0
 Identities = 11/32 (34%), Positives = 18/32 (56%)
 Frame = +1

Query: 292 YYVTIIDAPGHRDFIKNMITGTSQADCAVLIV 387
           + V +ID+PGH DF   +       D A+++V
Sbjct: 98  FLVNLIDSPGHVDFSSEVTAALRVTDGALVVV 129


>SPAC513.01c |eft201|eft2-1, etf2, SPAPYUK71.04c|translation
           elongation factor 2 |Schizosaccharomyces pombe|chr
           1|||Manual
          Length = 842

 Score = 35.5 bits (78), Expect = 0.010
 Identities = 17/32 (53%), Positives = 19/32 (59%)
 Frame = +3

Query: 42  MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCG 137
           MGK     N+ VI HVD GKST T  L+ K G
Sbjct: 13  MGKPSNVRNMSVIAHVDHGKSTLTDSLVQKAG 44



 Score = 27.9 bits (59), Expect = 2.0
 Identities = 11/32 (34%), Positives = 18/32 (56%)
 Frame = +1

Query: 292 YYVTIIDAPGHRDFIKNMITGTSQADCAVLIV 387
           + V +ID+PGH DF   +       D A+++V
Sbjct: 98  FLVNLIDSPGHVDFSSEVTAALRVTDGALVVV 129


>SPBC1306.01c ||SPBC409.22c|translation elongation factor
           G|Schizosaccharomyces pombe|chr 2|||Manual
          Length = 770

 Score = 34.3 bits (75), Expect = 0.023
 Identities = 21/57 (36%), Positives = 29/57 (50%)
 Frame = +1

Query: 277 FETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREH 447
           FE S Y + IID PGH DF   +       D AVL++ A +G     I+ + Q R +
Sbjct: 141 FEKS-YNINIIDTPGHIDFTIEVERALRVLDGAVLVLCAVSGVQSQTITVDRQMRRY 196



 Score = 29.1 bits (62), Expect = 0.87
 Identities = 12/26 (46%), Positives = 17/26 (65%)
 Frame = +3

Query: 66  NIVVIGHVDSGKSTTTGHLIYKCGGI 143
           NI +  H+DSGK+T T  ++Y  G I
Sbjct: 61  NIGISAHIDSGKTTFTERVLYYTGRI 86


>SPBC1271.15c |||translation initiation factor
           IF-2Mt|Schizosaccharomyces pombe|chr 2|||Manual
          Length = 686

 Score = 33.5 bits (73), Expect = 0.041
 Identities = 15/42 (35%), Positives = 21/42 (50%)
 Frame = +1

Query: 277 FETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTG 402
           F+    ++T +D PGH  F      G + AD  VL+VA   G
Sbjct: 215 FDKGSKFITFLDTPGHMAFEAMRKRGANIADIVVLVVAGDDG 256


>SPCC553.08c |||GTPase Ria1 |Schizosaccharomyces pombe|chr
           3|||Manual
          Length = 1000

 Score = 31.1 bits (67), Expect = 0.22
 Identities = 23/74 (31%), Positives = 37/74 (50%)
 Frame = +1

Query: 292 YYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALLAFTLG 471
           Y + +ID+PGH DF   + + +   D A ++V A  G     I+   Q       A+   
Sbjct: 94  YLINLIDSPGHVDFSSEVSSASRLCDGAFVLVDAVEGVCSQTITVLRQ-------AWIDR 146

Query: 472 VKQLIVGVNKMDSL 513
           +K ++V +NKMD L
Sbjct: 147 IKVILV-INKMDRL 159


>SPAC1B3.04c |||mitochondrial GTPase Guf1 |Schizosaccharomyces
           pombe|chr 1|||Manual
          Length = 646

 Score = 30.7 bits (66), Expect = 0.29
 Identities = 12/45 (26%), Positives = 23/45 (51%)
 Frame = +1

Query: 268 LWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTG 402
           ++ +    Y + +ID PGH DF   ++   +  +  +L+V A  G
Sbjct: 116 IYYYHGQSYLLNLIDTPGHVDFRAEVMHSLAACEGCILLVDASQG 160


>SPBC660.10 |||translation elongation factor G|Schizosaccharomyces
           pombe|chr 2|||Manual
          Length = 813

 Score = 29.9 bits (64), Expect = 0.50
 Identities = 26/84 (30%), Positives = 38/84 (45%)
 Frame = +1

Query: 256 IDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQ 435
           I+ A   F      + +ID PGH DF   +    +  D AV I+     +  AG+    Q
Sbjct: 81  INSAAISFTWRNQRINLIDTPGHADFTFEVERSVAVLDGAVAII-----DGSAGV--EAQ 133

Query: 436 TREHALLAFTLGVKQLIVGVNKMD 507
           T+     A   G+ ++I  VNKMD
Sbjct: 134 TKVVWKQATKRGIPKVIF-VNKMD 156



 Score = 28.7 bits (61), Expect = 1.2
 Identities = 10/24 (41%), Positives = 17/24 (70%)
 Frame = +3

Query: 66  NIVVIGHVDSGKSTTTGHLIYKCG 137
           N+ +I H+D+GK+T T  ++Y  G
Sbjct: 30  NVGIIAHIDAGKTTLTEKMLYYGG 53


>SPAC56F8.03 |||translation initiation factor IF2
           |Schizosaccharomyces pombe|chr 1|||Manual
          Length = 1079

 Score = 29.5 bits (63), Expect = 0.66
 Identities = 12/28 (42%), Positives = 16/28 (57%)
 Frame = +1

Query: 304 IIDAPGHRDFIKNMITGTSQADCAVLIV 387
           IID PGH  F      GTS  + A+L++
Sbjct: 553 IIDTPGHESFTNLRSRGTSLCNIAILVI 580


>SPBC215.12 |cwf10|spef2, snu114|GTPase Cwf10 |Schizosaccharomyces
           pombe|chr 2|||Manual
          Length = 983

 Score = 28.3 bits (60), Expect = 1.5
 Identities = 13/51 (25%), Positives = 25/51 (49%)
 Frame = +1

Query: 235 LSVXRYQIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIV 387
           +S+    + +A+   +   +    ID PGH DF+  +    + +D  VL+V
Sbjct: 190 MSIKSTPLTLAVSDMKGKTFAFQCIDTPGHVDFVDEVAAPMAISDGVVLVV 240


>SPAC1093.01 ||SPAC12B10.18|PPR repeat protein|Schizosaccharomyces
           pombe|chr 1|||Manual
          Length = 1261

 Score = 27.5 bits (58), Expect = 2.7
 Identities = 8/19 (42%), Positives = 13/19 (68%)
 Frame = -3

Query: 264 NIDLIPXHAQPLVCPIPKH 208
           N+DL+  HA P++C +  H
Sbjct: 531 NVDLLHLHAYPVICSVSSH 549


>SPBC1703.06 |pof10||F-box protein Pof10|Schizosaccharomyces
           pombe|chr 2|||Manual
          Length = 662

 Score = 26.6 bits (56), Expect = 4.7
 Identities = 19/62 (30%), Positives = 24/62 (38%)
 Frame = -3

Query: 285 SFELPESNIDLIPXHAQPLVCPIPKHI*RILYPFPGPPSRTSRWYVCQYHHICRSSDQWW 106
           S  L   N D    +    V  +PK I  I++ F  P S  S    C+Y     S D  W
Sbjct: 12  SSNLRRMNRDHSSNNTNRTVLNLPKEILIIIFSFLDPRSLLSAQCTCKYWKKLLSDDLSW 71

Query: 105 WT 100
            T
Sbjct: 72  RT 73


>SPAC9G1.11c |spn4||septin Spn4|Schizosaccharomyces pombe|chr
           1|||Manual
          Length = 380

 Score = 26.2 bits (55), Expect = 6.1
 Identities = 12/32 (37%), Positives = 19/32 (59%), Gaps = 2/32 (6%)
 Frame = +1

Query: 253 QIDIALWKFETSKYYV--TIIDAPGHRDFIKN 342
           +I+I   + E   +++  T+ID PG  DFI N
Sbjct: 72  EIEITKAELEEKNFHLRLTVIDTPGFGDFINN 103


>SPAPB1A10.07c |||sphingolipid biosynthesis
           protein|Schizosaccharomyces pombe|chr 1|||Manual
          Length = 441

 Score = 26.2 bits (55), Expect = 6.1
 Identities = 10/33 (30%), Positives = 14/33 (42%)
 Frame = -3

Query: 786 REDAGACQGXGRWQDGIESFNEAFSVSFAFLTL 688
           R D G C   G    G   F++    +F F T+
Sbjct: 285 RPDEGQCNPWGNSASGTREFSKVIGAAFTFFTI 317


  Database: spombe
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 2,362,478
  Number of sequences in database:  5004
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 3,647,637
Number of Sequences: 5004
Number of extensions: 76886
Number of successful extensions: 274
Number of sequences better than 10.0: 20
Number of HSP's better than 10.0 without gapping: 238
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 261
length of database: 2,362,478
effective HSP length: 72
effective length of database: 2,002,190
effective search space used: 440481800
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -