SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= psV30142.Seq
         (600 letters)

Database: spombe 
           5004 sequences; 2,362,478 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SPAC24H6.06 |sld3|mug175|DNA replication pre-initiation complex ...    26   3.7  

>SPAC24H6.06 |sld3|mug175|DNA replication pre-initiation complex
           subunit Sld3 |Schizosaccharomyces pombe|chr 1|||Manual
          Length = 668

 Score = 26.2 bits (55), Expect = 3.7
 Identities = 17/62 (27%), Positives = 31/62 (50%)
 Frame = +1

Query: 169 KILM*VGTLKTKERKREREIQCIFN*LNKPKWPLLKFINHRNCSLCKYVYIYYFNKRNSE 348
           ++L  +  LK+ + ++ R +QC  + LN   W  L+F N  +    K   ++  N  N E
Sbjct: 260 ELLKFLDNLKSVDDRKSRLLQCFESHLNYKAWH-LEFENEAHQYEIKGYRLWLQNILNRE 318

Query: 349 DC 354
           +C
Sbjct: 319 NC 320


  Database: spombe
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 2,362,478
  Number of sequences in database:  5004
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 1,799,442
Number of Sequences: 5004
Number of extensions: 31784
Number of successful extensions: 46
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 46
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 46
length of database: 2,362,478
effective HSP length: 69
effective length of database: 2,017,202
effective search space used: 262236260
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -