SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= psV30141.Seq
         (897 letters)

Database: spombe 
           5004 sequences; 2,362,478 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SPBC16G5.06 |||sequence orphan|Schizosaccharomyces pombe|chr 2||...    31   0.29 
SPAC1F3.02c |mkh1||MEK kinase |Schizosaccharomyces pombe|chr 1||...    29   0.90 
SPAC1B3.13 |||U3 snoRNP-associated protein Nan1|Schizosaccharomy...    29   0.90 
SPCC1827.01c |||DUF1253 family protein|Schizosaccharomyces pombe...    28   2.1  
SPCC1827.03c |||acetyl-CoA ligase |Schizosaccharomyces pombe|chr...    28   2.1  
SPBC582.03 |cdc13||cyclin Cdc13|Schizosaccharomyces pombe|chr 2|...    27   3.6  
SPAC14C4.11 |||polyphosphate synthetase |Schizosaccharomyces pom...    27   3.6  
SPCC962.01 ||SPCP31B10.09|C2 domain protein|Schizosaccharomyces ...    26   6.3  
SPBC19C7.09c |uve1|uvde|endonuclease Uve1 |Schizosaccharomyces p...    26   6.3  

>SPBC16G5.06 |||sequence orphan|Schizosaccharomyces pombe|chr
           2|||Manual
          Length = 230

 Score = 30.7 bits (66), Expect = 0.29
 Identities = 19/47 (40%), Positives = 25/47 (53%)
 Frame = -3

Query: 394 LPRNCSQAVVRSSSSFMILHWATPVTVSGTPWAVSTYSHIGFNVITS 254
           L R  S +   SSSS    H + P T S +P + ST S  G +VIT+
Sbjct: 48  LYRRASTSSSSSSSSISTSHDSQPSTSSSSPSSTSTSSSSGTSVITA 94


>SPAC1F3.02c |mkh1||MEK kinase |Schizosaccharomyces pombe|chr
           1|||Manual
          Length = 1116

 Score = 29.1 bits (62), Expect = 0.90
 Identities = 16/46 (34%), Positives = 24/46 (52%), Gaps = 1/46 (2%)
 Frame = +2

Query: 329 RPVQDHERRRTSHNCLRAVPGQDRQRD-*DDCPANVGGSFASYSRN 463
           +PV +H+ ++TS      VPG  R +D   DCP++    F   S N
Sbjct: 218 QPVSEHKEKQTSFLRRFRVPGFSRDKDKTKDCPSSNSNPFHLASSN 263


>SPAC1B3.13 |||U3 snoRNP-associated protein Nan1|Schizosaccharomyces
           pombe|chr 1|||Manual
          Length = 800

 Score = 29.1 bits (62), Expect = 0.90
 Identities = 13/33 (39%), Positives = 19/33 (57%)
 Frame = -2

Query: 125 MLPILNPFTVTFTIHTLHFTTKTITNLFNLPKN 27
           +L + NP + +  +H    TT  I NLFN+P N
Sbjct: 734 LLNLENPISGSQGLHYKRLTTDMIHNLFNVPSN 766


>SPCC1827.01c |||DUF1253 family protein|Schizosaccharomyces
           pombe|chr 3|||Manual
          Length = 652

 Score = 27.9 bits (59), Expect = 2.1
 Identities = 17/51 (33%), Positives = 25/51 (49%), Gaps = 1/51 (1%)
 Frame = -2

Query: 299 GRFNVLAHRVQCHHFRDIRWTSVTRHQAHAHPPTMVRFVVG-PKQPPETIS 150
           GR N++ +  + HHFR   +  V     +  PPT  +F V   + P  TIS
Sbjct: 557 GRTNIMLYTERAHHFRRFDFRGVKAVVMYG-PPTNPQFYVELVRMPMRTIS 606


>SPCC1827.03c |||acetyl-CoA ligase |Schizosaccharomyces pombe|chr
           3|||Manual
          Length = 512

 Score = 27.9 bits (59), Expect = 2.1
 Identities = 17/51 (33%), Positives = 27/51 (52%), Gaps = 2/51 (3%)
 Frame = -3

Query: 511 QPANWSLSLYTSSTVRVPRIARK*PSNVCRTV--ILISLTVLPRNCSQAVV 365
           QP +  L L+TS T   P++      N+CR++  I  S  + PR+ S  V+
Sbjct: 159 QPDDVMLVLHTSGTTGRPKVVPLTHKNLCRSIHNITTSYRLDPRDTSYVVM 209


>SPBC582.03 |cdc13||cyclin Cdc13|Schizosaccharomyces pombe|chr
           2|||Manual
          Length = 482

 Score = 27.1 bits (57), Expect = 3.6
 Identities = 14/38 (36%), Positives = 22/38 (57%)
 Frame = -3

Query: 637 TLAVANFPKLAQILDIVVDVLNREGQNLDSHSSDVRRS 524
           T++  N PK    LD V +  N+EG  L S +++VR +
Sbjct: 49  TVSSTNVPKKRHALDDVSNFHNKEGVPLASKNTNVRHT 86


>SPAC14C4.11 |||polyphosphate synthetase |Schizosaccharomyces
           pombe|chr 1|||Manual
          Length = 734

 Score = 27.1 bits (57), Expect = 3.6
 Identities = 15/40 (37%), Positives = 23/40 (57%)
 Frame = -3

Query: 655 RSASLFTLAVANFPKLAQILDIVVDVLNREGQNLDSHSSD 536
           RS   ++L +  + KL    DI+V+ + R+G  L SHS D
Sbjct: 269 RSEQAYSLRLHWYGKLTPKTDIIVERMVRQGSTL-SHSED 307



 Score = 26.2 bits (55), Expect = 6.3
 Identities = 16/54 (29%), Positives = 26/54 (48%), Gaps = 1/54 (1%)
 Frame = -3

Query: 601 ILDIVVDVLNREGQNLDSHSSDVRRSHFAYQ-PANWSLSLYTSSTVRVPRIARK 443
           ILD +   L  +  N D +S ++ RS  AY    +W   L   + + V R+ R+
Sbjct: 245 ILDPISTCLYLDNSNFDLYSQNLERSEQAYSLRLHWYGKLTPKTDIIVERMVRQ 298


>SPCC962.01 ||SPCP31B10.09|C2 domain protein|Schizosaccharomyces
            pombe|chr 3|||Manual
          Length = 1429

 Score = 26.2 bits (55), Expect = 6.3
 Identities = 10/18 (55%), Positives = 13/18 (72%)
 Frame = +3

Query: 243  TYIPEVMTLNPMCEYVET 296
            TY+P  MTLNPM  Y+ +
Sbjct: 1060 TYMPVPMTLNPMESYINS 1077


>SPBC19C7.09c |uve1|uvde|endonuclease Uve1 |Schizosaccharomyces
           pombe|chr 2|||Manual
          Length = 599

 Score = 26.2 bits (55), Expect = 6.3
 Identities = 20/73 (27%), Positives = 36/73 (49%)
 Frame = -3

Query: 661 HGRSASLFTLAVANFPKLAQILDIVVDVLNREGQNLDSHSSDVRRSHFAYQPANWSLSLY 482
           H +S S  T   A   K  +  D V D ++    + DS S+ +RRS  + +P N++ S  
Sbjct: 98  HKKSTSTSTRKRARSSK-KKATDSVSDKIDESVASYDS-STHLRRSSRSKKPVNYNSSSE 155

Query: 481 TSSTVRVPRIARK 443
           + S  ++ +  +K
Sbjct: 156 SESEEQISKATKK 168


  Database: spombe
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 2,362,478
  Number of sequences in database:  5004
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 3,933,584
Number of Sequences: 5004
Number of extensions: 86982
Number of successful extensions: 255
Number of sequences better than 10.0: 9
Number of HSP's better than 10.0 without gapping: 246
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 255
length of database: 2,362,478
effective HSP length: 72
effective length of database: 2,002,190
effective search space used: 452494940
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -