SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= psV30139.Seq
         (697 letters)

Database: spombe 
           5004 sequences; 2,362,478 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SPBC1703.12 |ubp9||ubiquitin C-terminal hydrolase Ubp9|Schizosac...    51   2e-07
SPCC1494.05c |ubp12||ubiquitin C-terminal hydrolase Ubp12|Schizo...    48   2e-06
SPCC1682.12c |ubp16||ubiquitin C-terminal hydrolase Ubp16|Schizo...    47   3e-06
SPBC18H10.08c |ubp4||ubiquitin C-terminal hydrolase Ubp4|Schizos...    46   5e-06
SPCC16A11.12c |ubp1||ubiquitin C-terminal hydrolase Ubp1|Schizos...    43   5e-05
SPAC23G3.08c |ubp7||ubiquitin C-terminal hydrolase Ubp7|Schizosa...    38   0.001
SPAC13A11.04c |ubp8||ubiquitin C-terminal hydrolase Ubp8|Schizos...    36   0.007
SPBC713.02c |ubp21|ubpD, ubp15|ubiquitin C-terminal hydrolase Ub...    34   0.017
SPBC6B1.06c |ubp14|ucp2|ubiquitin C-terminal hydrolase Ubp14|Sch...    29   0.64 
SPCC188.08c |ubp22|ubp5|ubiquitin C-terminal hydrolase Ubp22|Sch...    27   2.6  
SPAC1296.04 |mug65||spore wall assembly protein |Schizosaccharom...    26   4.5  
SPAC25G10.09c ||SPAC27F1.01c|actin cortical patch component, wit...    25   7.8  

>SPBC1703.12 |ubp9||ubiquitin C-terminal hydrolase
           Ubp9|Schizosaccharomyces pombe|chr 2|||Manual
          Length = 585

 Score = 50.8 bits (116), Expect = 2e-07
 Identities = 30/100 (30%), Positives = 44/100 (44%)
 Frame = +3

Query: 312 SLQDCLAAFFSADELKGDNMYSCSRCKKLRNGVKLSGIVVLPXVLCVHLKRFRHELLFSA 491
           S+  CL +F +++ L   N + C  CK L+   K   I  LP +L +HLKRF++      
Sbjct: 269 SVTSCLRSFSASEMLSSKNKFHCDVCKSLQEAEKRMKIKKLPKILSLHLKRFKYNETQEG 328

Query: 492 KVXXXXXXXXTIWT*RLTRTKSAPRXVSRYSLXAVISHMG 611
                     T      T T+ A      Y L +VI H+G
Sbjct: 329 HDKLFYTIVFTNEMRLFTTTEDAENAERMYYLSSVIVHVG 368



 Score = 42.3 bits (95), Expect = 6e-05
 Identities = 20/57 (35%), Positives = 33/57 (57%)
 Frame = +1

Query: 40  GDGSNVKYRSIISDVFXGKLLSAVQCLICDRVSTRIETFQDLSLPIPSREHLAVLRC 210
           G+ S+V +   +  +F G L S  +CL C+ +++R E+F DLS+ I    H +V  C
Sbjct: 219 GNHSDVMHPKWVHSLFEGTLTSETKCLTCENITSRDESFLDLSIDI--ENHTSVTSC 273


>SPCC1494.05c |ubp12||ubiquitin C-terminal hydrolase
            Ubp12|Schizosaccharomyces pombe|chr 3|||Manual
          Length = 979

 Score = 47.6 bits (108), Expect = 2e-06
 Identities = 33/112 (29%), Positives = 48/112 (42%), Gaps = 6/112 (5%)
 Frame = +3

Query: 309  VSLQDCLAAFFSADELKGDNMYSCSRCKKLRNGVKLSGIVVLPXVLCVHLKRFRHELLFS 488
            ++L DCL  F   ++L  ++ + C  CK+ R   K   I   P +L  HLKRF  E  F 
Sbjct: 825  ITLNDCLDEFEKTEQLGEEDPWYCPTCKEFRQASKQMEIWRCPEILIFHLKRFSSERRFR 884

Query: 489  AKVXXXXXXXXTIWT*RL------TRTKSAPRXVSRYSLXAVISHMGTVGGG 626
             K+              +         K  P+ +  Y L AV +H G +GGG
Sbjct: 885  DKIDDLVEFPIDNLDMSMRTGSYKLSEKENPKLI--YELYAVDNHYGGLGGG 934



 Score = 39.9 bits (89), Expect = 3e-04
 Identities = 16/41 (39%), Positives = 26/41 (63%)
 Frame = +1

Query: 67  SIISDVFXGKLLSAVQCLICDRVSTRIETFQDLSLPIPSRE 189
           S+I D+F G   S + C +C+ VS   + F DL+LP+P ++
Sbjct: 457 SLIVDLFQGMYRSTLVCPVCNTVSITFDPFMDLTLPLPVKQ 497


>SPCC1682.12c |ubp16||ubiquitin C-terminal hydrolase
           Ubp16|Schizosaccharomyces pombe|chr 3|||Manual
          Length = 457

 Score = 46.8 bits (106), Expect = 3e-06
 Identities = 31/100 (31%), Positives = 41/100 (41%)
 Frame = +3

Query: 312 SLQDCLAAFFSADELKGDNMYSCSRCKKLRNGVKLSGIVVLPXVLCVHLKRFRHELLFSA 491
           SL D L  F  A++L   N Y C  CK+L +  K   I   P +L +H KRF      S+
Sbjct: 285 SLADSLKHFVHAEKLTKQNKYRCENCKQLVDASKQMTIYRAPNILTIHFKRFTFNGFQSS 344

Query: 492 KVXXXXXXXXTIWT*RLTRTKSAPRXVSRYSLXAVISHMG 611
           K+        +     L    S P     Y L  V+ H G
Sbjct: 345 KISKQISYPESF---NLGPYMSDPNCSCWYELIGVLVHAG 381


>SPBC18H10.08c |ubp4||ubiquitin C-terminal hydrolase
           Ubp4|Schizosaccharomyces pombe|chr 2|||Manual
          Length = 438

 Score = 46.0 bits (104), Expect = 5e-06
 Identities = 33/110 (30%), Positives = 53/110 (48%), Gaps = 3/110 (2%)
 Frame = +3

Query: 306 VVSLQDCLAAFFSADELKGDNMYSCSRCKKLRNGVKLSGIVVLPXVLCVHLKRFRHELLF 485
           VVSLQ+CL  F + + L+G + + C  CK  R+  K+  I  LP  L + ++RF+  ++ 
Sbjct: 265 VVSLQECLLKFSAPELLQGHDGWHCPVCKVQRSAKKVIMISKLPEYLIIQIQRFKISVMG 324

Query: 486 SAKVXXXXXXXXTIWT*RLT--RTKSAPRXV-SRYSLXAVISHMGTVGGG 626
             K+         I +  L     +S    + S Y+L A I H G +  G
Sbjct: 325 RKKIDTPLGLSLQIPSKMLVPPSFQSGIGYIPSNYNLFAFICHYGQLENG 374



 Score = 41.1 bits (92), Expect = 1e-04
 Identities = 18/48 (37%), Positives = 27/48 (56%)
 Frame = +1

Query: 64  RSIISDVFXGKLLSAVQCLICDRVSTRIETFQDLSLPIPSREHLAVLR 207
           +SI+ + F G+L S  QC+ C R ST    F  L++PI    H+  L+
Sbjct: 222 KSIVVNNFVGQLCSRTQCMTCGRTSTTFAPFTSLAIPIDDVSHVVSLQ 269


>SPCC16A11.12c |ubp1||ubiquitin C-terminal hydrolase
           Ubp1|Schizosaccharomyces pombe|chr 3|||Manual
          Length = 849

 Score = 42.7 bits (96), Expect = 5e-05
 Identities = 20/58 (34%), Positives = 30/58 (51%)
 Frame = +3

Query: 294 FYGPVVSLQDCLAAFFSADELKGDNMYSCSRCKKLRNGVKLSGIVVLPXVLCVHLKRF 467
           F+   ++L+DCL  F   ++L   + + C  CK  R   K   I  LP +L +HL RF
Sbjct: 685 FHMESITLEDCLLEFSKPEQLDLQDSWYCPGCKAFRPATKRLEIWRLPKILVIHLNRF 742



 Score = 35.9 bits (79), Expect = 0.006
 Identities = 16/39 (41%), Positives = 24/39 (61%)
 Frame = +1

Query: 67  SIISDVFXGKLLSAVQCLICDRVSTRIETFQDLSLPIPS 183
           SII  +F G   S ++C IC + ST  + F  L+LP+P+
Sbjct: 426 SIIVQLFQGMYKSTLECSICYQKSTAFDPFMYLTLPLPT 464


>SPAC23G3.08c |ubp7||ubiquitin C-terminal hydrolase
           Ubp7|Schizosaccharomyces pombe|chr 1|||Manual
          Length = 875

 Score = 38.3 bits (85), Expect = 0.001
 Identities = 15/36 (41%), Positives = 22/36 (61%)
 Frame = +1

Query: 70  IISDVFXGKLLSAVQCLICDRVSTRIETFQDLSLPI 177
           +I  +F G+L S V C  C+ ++   E  QDLS+PI
Sbjct: 522 VIKSIFTGRLTSVVMCQSCNEITNTPEPIQDLSIPI 557



 Score = 33.9 bits (74), Expect(2) = 0.001
 Identities = 14/33 (42%), Positives = 19/33 (57%)
 Frame = +3

Query: 312 SLQDCLAAFFSADELKGDNMYSCSRCKKLRNGV 410
           +L DCL  F   +EL G+NM++C  C    N V
Sbjct: 675 TLIDCLKNFTHVEELSGENMFACENCCNQPNEV 707



 Score = 23.4 bits (48), Expect(2) = 0.001
 Identities = 9/16 (56%), Positives = 11/16 (68%)
 Frame = +3

Query: 432 LPXVLCVHLKRFRHEL 479
           LP V  +HLKRF  E+
Sbjct: 742 LPPVFIIHLKRFFQEI 757


>SPAC13A11.04c |ubp8||ubiquitin C-terminal hydrolase
           Ubp8|Schizosaccharomyces pombe|chr 1|||Manual
          Length = 449

 Score = 35.5 bits (78), Expect = 0.007
 Identities = 21/63 (33%), Positives = 33/63 (52%), Gaps = 1/63 (1%)
 Frame = +3

Query: 312 SLQDCLAAFFSADELKGDNMYSCSRCKKLRNGVKLSGIVVLPXVLCVHLKRF-RHELLFS 488
           +LQ CL  F S ++++    YSC  C   +N +K      LP  +C+ LKRF ++    S
Sbjct: 299 TLQGCLERFVSKEKVQ----YSCHSCGS-KNAIKQLVFDKLPPTICMQLKRFEQNNFAMS 353

Query: 489 AKV 497
            K+
Sbjct: 354 TKI 356



 Score = 32.3 bits (70), Expect = 0.068
 Identities = 15/47 (31%), Positives = 24/47 (51%)
 Frame = +1

Query: 37  SGDGSNVKYRSIISDVFXGKLLSAVQCLICDRVSTRIETFQDLSLPI 177
           SG G+++     I  +F G L + V CL C +    ++   D+SL I
Sbjct: 249 SGGGTSMPCTCPIHRIFSGSLKNVVTCLDCKKERVAVDPLMDISLDI 295


>SPBC713.02c |ubp21|ubpD, ubp15|ubiquitin C-terminal hydrolase
           Ubp21|Schizosaccharomyces pombe|chr 2|||Manual
          Length = 1129

 Score = 34.3 bits (75), Expect = 0.017
 Identities = 14/41 (34%), Positives = 26/41 (63%)
 Frame = +1

Query: 73  ISDVFXGKLLSAVQCLICDRVSTRIETFQDLSLPIPSREHL 195
           ++D+F GK+ S V+C+  +  S+R+E F D+ L +   + L
Sbjct: 336 LNDIFVGKMKSYVKCIDVNYESSRVEDFWDIQLNVKGMDTL 376


>SPBC6B1.06c |ubp14|ucp2|ubiquitin C-terminal hydrolase
           Ubp14|Schizosaccharomyces pombe|chr 2|||Manual
          Length = 775

 Score = 29.1 bits (62), Expect = 0.64
 Identities = 15/53 (28%), Positives = 23/53 (43%)
 Frame = +3

Query: 309 VSLQDCLAAFFSADELKGDNMYSCSRCKKLRNGVKLSGIVVLPXVLCVHLKRF 467
           VS+  CL A    D+++    Y+C  CK        + +   P VL +   RF
Sbjct: 481 VSIDQCLDATIQPDQME----YTCEACKSKLGATTTTAMKSFPKVLILQANRF 529


>SPCC188.08c |ubp22|ubp5|ubiquitin C-terminal hydrolase
           Ubp22|Schizosaccharomyces pombe|chr 3|||Manual
          Length = 1108

 Score = 27.1 bits (57), Expect = 2.6
 Identities = 15/57 (26%), Positives = 28/57 (49%), Gaps = 2/57 (3%)
 Frame = +3

Query: 312 SLQDCLAAFFSADELKGDNMYSCSR--CKKLRNGVKLSGIVVLPXVLCVHLKRFRHE 476
           +L+D   ++   + L+GDN Y       ++ + GV        P +L + LKRF ++
Sbjct: 358 NLEDSFRSYIQVETLEGDNCYFADTYGFQEAKKGVIFES---FPPILHLQLKRFEYD 411


>SPAC1296.04 |mug65||spore wall assembly protein
           |Schizosaccharomyces pombe|chr 1|||Manual
          Length = 248

 Score = 26.2 bits (55), Expect = 4.5
 Identities = 11/32 (34%), Positives = 21/32 (65%)
 Frame = +3

Query: 24  KKRFIRRRQQREVPKHHIRRVRXEVTISRSVP 119
           ++R+IR+R+++E+ +  +  V    TIS S P
Sbjct: 107 RRRWIRKRKKKELRRDELPLVPESFTISSSYP 138


>SPAC25G10.09c ||SPAC27F1.01c|actin cortical patch component, with EF
            hand and WH2 motif |Schizosaccharomyces pombe|chr
            1|||Manual
          Length = 1794

 Score = 25.4 bits (53), Expect = 7.8
 Identities = 11/20 (55%), Positives = 13/20 (65%)
 Frame = +1

Query: 334  PSSAPTNSKATTCTAAPAAR 393
            PS AP NS  +T  AAP A+
Sbjct: 1258 PSPAPVNSATSTPVAAPTAQ 1277


  Database: spombe
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 2,362,478
  Number of sequences in database:  5004
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 2,364,270
Number of Sequences: 5004
Number of extensions: 38378
Number of successful extensions: 114
Number of sequences better than 10.0: 12
Number of HSP's better than 10.0 without gapping: 99
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 114
length of database: 2,362,478
effective HSP length: 71
effective length of database: 2,007,194
effective search space used: 321151040
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -