SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= psV30137.Seq
         (875 letters)

Database: spombe 
           5004 sequences; 2,362,478 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SPBC1773.10c |||asparagine-tRNA ligase Ded81 |Schizosaccharomyce...    95   9e-21
SPAC26H5.06 |pot1||telomere end-binding protein Pot1 |Schizosacc...    30   0.38 
SPAC922.03 |||1-aminocyclopropane-1-carboxylate deaminase |Schiz...    28   2.0  
SPAC1D4.10 |||tRNA endonuclease|Schizosaccharomyces pombe|chr 1|...    27   2.7  
SPAC2F7.15 |rsm24||mitochondrial ribosomal protein subunit S24|S...    27   4.6  
SPCC4B3.03c |||DUF21 domain protein|Schizosaccharomyces pombe|ch...    26   6.1  
SPAC22A12.07c |ogm1|oma1|protein O-mannosyltransferase Ogm1|Schi...    26   6.1  
SPAC11H11.06 |arp2|SPAC22F8.01|ARP2/3 actin-organizing complex s...    26   6.1  

>SPBC1773.10c |||asparagine-tRNA ligase Ded81 |Schizosaccharomyces
           pombe|chr 2|||Manual
          Length = 568

 Score = 95.5 bits (227), Expect = 9e-21
 Identities = 53/112 (47%), Positives = 68/112 (60%), Gaps = 4/112 (3%)
 Frame = +1

Query: 511 WVHRLRRQGKSLAFLTLRDGTGYLQCVLHGLLCQ--TYNALVLSTESSVVLYGKLEAVPE 684
           WVHR+R Q K + F+ LRDGTG+LQCVL G +    +Y+ + L  ES+V LYG ++ +PE
Sbjct: 149 WVHRMRTQ-KGIIFIILRDGTGFLQCVLSGKVYDRASYDFINLGPESTVCLYGVIKELPE 207

Query: 685 GKKAPGGHELTADYWGIDWTRTT--RWCDAILNEEALPDVQLDHRXIMIRXE 834
           GK APG HEL  DY+ I     T        LN EA P   LD R ++IR E
Sbjct: 208 GKSAPGNHELVVDYYQILHAAPTGEEAFTNRLNAEAEPSYLLDQRHLVIRGE 259


>SPAC26H5.06 |pot1||telomere end-binding protein Pot1
           |Schizosaccharomyces pombe|chr 1|||Manual
          Length = 555

 Score = 30.3 bits (65), Expect = 0.38
 Identities = 15/53 (28%), Positives = 25/53 (47%), Gaps = 3/53 (5%)
 Frame = +1

Query: 496 DMHQRWVHRLRRQGKSLAFLTLR---DGTGYLQCVLHGLLCQTYNALVLSTES 645
           D H  +     ++G  +    +R   D  GYL+C+LHG   + YN  +   +S
Sbjct: 269 DEHDFYCRNYIKEGDYVVMKNVRTKIDHLGYLECILHGDSAKRYNMSIEKVDS 321


>SPAC922.03 |||1-aminocyclopropane-1-carboxylate deaminase
           |Schizosaccharomyces pombe|chr 1|||Manual
          Length = 338

 Score = 27.9 bits (59), Expect = 2.0
 Identities = 14/45 (31%), Positives = 19/45 (42%)
 Frame = +3

Query: 108 VGNLSLSEIYTSXXXXXXXXXXXXXEKPFKTILKAMHHAGKEPFP 242
           VGN+ LS I  +                FK  L+ +   GK+PFP
Sbjct: 113 VGNIELSRIVNADVRLDSSKFDIGIRPSFKNALEELTKKGKKPFP 157


>SPAC1D4.10 |||tRNA endonuclease|Schizosaccharomyces pombe|chr
           1|||Manual
          Length = 809

 Score = 27.5 bits (58), Expect = 2.7
 Identities = 13/34 (38%), Positives = 15/34 (44%), Gaps = 1/34 (2%)
 Frame = -2

Query: 757 TWWCESNQFPSNQLSAHDHPEP-SFPRAQPLIFH 659
           TWW     FP   LS +D  EP     A P + H
Sbjct: 119 TWWDSCGGFPGFLLSLNDISEPGETGEASPFVLH 152


>SPAC2F7.15 |rsm24||mitochondrial ribosomal protein subunit
           S24|Schizosaccharomyces pombe|chr 1|||Manual
          Length = 258

 Score = 26.6 bits (56), Expect = 4.6
 Identities = 10/24 (41%), Positives = 14/24 (58%)
 Frame = +2

Query: 179 ERETIQDNIESNASCWQRAISHNL 250
           E +TI DN+ SN   WQ+   H +
Sbjct: 59  ELKTIDDNVHSNNLSWQKIQEHEV 82


>SPCC4B3.03c |||DUF21 domain protein|Schizosaccharomyces pombe|chr
           3|||Manual
          Length = 679

 Score = 26.2 bits (55), Expect = 6.1
 Identities = 21/69 (30%), Positives = 37/69 (53%), Gaps = 4/69 (5%)
 Frame = +1

Query: 490 SEDMHQRWVHRLRRQGKSLAFLTLRDG----TGYLQCVLHGLLCQTYNALVLSTESSVVL 657
           SE +H R V +L R+GK    +TL  G       L  V   ++   + A+++ST + +V+
Sbjct: 104 SERVHARKVLKLLRRGKHWVLVTLLLGNVIVNETLPIVFDSIIGGGWPAVLIST-AMIVI 162

Query: 658 YGKLEAVPE 684
           +G  E +P+
Sbjct: 163 FG--EVIPQ 169


>SPAC22A12.07c |ogm1|oma1|protein O-mannosyltransferase
           Ogm1|Schizosaccharomyces pombe|chr 1|||Manual
          Length = 893

 Score = 26.2 bits (55), Expect = 6.1
 Identities = 17/55 (30%), Positives = 26/55 (47%), Gaps = 6/55 (10%)
 Frame = -1

Query: 254 NINCGKWLFASMMHCFQYCLEW---FLFRTITCIVIAILIRGI---YLGQAKVSN 108
           N N GK++ A ++H   Y LE    FL+  +  +   I   G+   +LG A   N
Sbjct: 611 NYNIGKFVVAWLLHWAPYILETDRVFLYHYLPALYFGIAALGVSWSFLGNAVFGN 665


>SPAC11H11.06 |arp2|SPAC22F8.01|ARP2/3 actin-organizing complex
           subunit Arp2|Schizosaccharomyces pombe|chr 1|||Manual
          Length = 390

 Score = 26.2 bits (55), Expect = 6.1
 Identities = 13/26 (50%), Positives = 15/26 (57%)
 Frame = +2

Query: 410 KKILLQEDPSLPKATVVKICETTEHR 487
           +KILL E P  P A   K+CET   R
Sbjct: 101 RKILLTEPPMNPVANREKMCETMFER 126


  Database: spombe
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 2,362,478
  Number of sequences in database:  5004
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 3,592,030
Number of Sequences: 5004
Number of extensions: 74529
Number of successful extensions: 241
Number of sequences better than 10.0: 8
Number of HSP's better than 10.0 without gapping: 233
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 240
length of database: 2,362,478
effective HSP length: 72
effective length of database: 2,002,190
effective search space used: 438479610
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -