SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= psV30135.Seq
         (856 letters)

Database: spombe 
           5004 sequences; 2,362,478 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SPBC32H8.12c |act1|cps8|actin |Schizosaccharomyces pombe|chr 2||...   174   1e-44
SPAC630.03 |arp3|act2|actin-like protein Arp3|Schizosaccharomyce...    99   9e-22
SPAC11H11.06 |arp2|SPAC22F8.01|ARP2/3 actin-organizing complex s...    99   9e-22
SPBC1347.12 |||actin-like protein Arp1 |Schizosaccharomyces pomb...    93   6e-20
SPBP23A10.08 |alp5|arp4|actin-like protein Arp4|Schizosaccharomy...    63   4e-11
SPBC365.10 |||actin-like protein Arp5 |Schizosaccharomyces pombe...    61   2e-10
SPAC23D3.09 |arp42|arp4|SWI/SNF and RSC complex subunit Arp42|Sc...    52   1e-07
SPCC550.12 |arp6||actin-like protein Arp6|Schizosaccharomyces po...    41   2e-04
SPAC1071.06 |arp9||SWI/SNF and RSC complex subunit Arp9|Schizosa...    37   0.003
SPAC26A3.05 |chc1||clathrin heavy chain Chc1 |Schizosaccharomyce...    32   0.12 
SPAPB24D3.07c |||sequence orphan|Schizosaccharomyces pombe|chr 1...    31   0.28 
SPAPB18E9.04c |||sequence orphan|Schizosaccharomyces pombe|chr 1...    30   0.48 
SPAC13F5.04c |||endosomal sorting protein |Schizosaccharomyces p...    29   0.84 
SPBC8D2.20c |sec31||COPII-coated vesicle component Sec31 |Schizo...    27   2.6  
SPAC20G8.05c |cdc15||cell division control protein Cdc15|Schizos...    27   2.6  
SPAC23A1.17 |||WIP homolog|Schizosaccharomyces pombe|chr 1|||Manual    27   3.4  
SPBC13E7.09 |vrp1||verprolin|Schizosaccharomyces pombe|chr 2|||M...    27   4.5  
SPAC56F8.02 |||AMP binding enzyme |Schizosaccharomyces pombe|chr...    26   5.9  
SPBC115.01c |rrp46||exosome subunit Rrp46 |Schizosaccharomyces p...    26   5.9  
SPBC3E7.12c |chr1|cfh4|chitin synthase regulatory factor |Schizo...    26   7.8  
SPAC6G10.10c |||human hmmtag2 homolog|Schizosaccharomyces pombe|...    26   7.8  

>SPBC32H8.12c |act1|cps8|actin |Schizosaccharomyces pombe|chr
           2|||Manual
          Length = 375

 Score =  174 bits (424), Expect = 1e-44
 Identities = 79/85 (92%), Positives = 81/85 (95%)
 Frame = +3

Query: 255 AQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANRE 434
           AQSKRGILTLKYPIEHGIV NWDDMEKIWHHTFYNELRVAPEEHP LLTEAPLNPK+NRE
Sbjct: 58  AQSKRGILTLKYPIEHGIVNNWDDMEKIWHHTFYNELRVAPEEHPCLLTEAPLNPKSNRE 117

Query: 435 KMTQIMFETFNTPAMYVAIQAVLSL 509
           KMTQI+FETFN PA YVAIQAVLSL
Sbjct: 118 KMTQIIFETFNAPAFYVAIQAVLSL 142



 Score =  124 bits (300), Expect = 1e-29
 Identities = 61/78 (78%), Positives = 65/78 (83%)
 Frame = +2

Query: 509 YASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDFSRSRLTDYLMKILTERGYSFIT 688
           YASGRTTGIVLDSGDGV+HTVPIYEGYALPHAI+RLD +   LTDYLMKIL ERGY+F T
Sbjct: 143 YASGRTTGIVLDSGDGVTHTVPIYEGYALPHAIMRLDLAGRDLTDYLMKILMERGYTFST 202

Query: 689 NAXREIRS*TFKEKLCYV 742
            A REI     KEKLCYV
Sbjct: 203 TAEREIVR-DIKEKLCYV 219



 Score =  119 bits (287), Expect = 5e-28
 Identities = 52/60 (86%), Positives = 58/60 (96%)
 Frame = +1

Query: 88  DEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEHRAK 267
           +EE+AALV+DNGSGMCKAGFAGDDAPRAVFPSIVGRPRH G+MVGMGQKDSYVGDE ++K
Sbjct: 2   EEEIAALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHHGIMVGMGQKDSYVGDEAQSK 61


>SPAC630.03 |arp3|act2|actin-like protein Arp3|Schizosaccharomyces
           pombe|chr 1|||Manual
          Length = 427

 Score = 98.7 bits (235), Expect = 9e-22
 Identities = 41/77 (53%), Positives = 53/77 (68%)
 Frame = +3

Query: 279 TLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFE 458
           +L YPI HG + NWD ME+ W  + +  LR  PE+H  LLTE PLNP  NRE   +IMFE
Sbjct: 89  SLDYPIRHGQIENWDHMERFWQQSLFKYLRCEPEDHYFLLTEPPLNPPENRENTAEIMFE 148

Query: 459 TFNTPAMYVAIQAVLSL 509
           +FN   +Y+A+QAVL+L
Sbjct: 149 SFNCAGLYIAVQAVLAL 165



 Score = 46.8 bits (106), Expect = 4e-06
 Identities = 26/74 (35%), Positives = 41/74 (55%), Gaps = 2/74 (2%)
 Frame = +2

Query: 527 TGIVLDSGDGVSHTVPIYEGYALPHAILRLDFSRSRLTDYLMKILTERGY--SFITNAXR 700
           TG V+DSGDGV+H +P+ EGY +  +I  +  +   +T ++  +L +R    S +  A R
Sbjct: 180 TGTVVDSGDGVTHIIPVAEGYVIGSSIKTMPLAGRDVTYFVQSLLRDRNEPDSSLKTAER 239

Query: 701 EIRS*TFKEKLCYV 742
                  KE+ CYV
Sbjct: 240 ------IKEECCYV 247



 Score = 42.7 bits (96), Expect = 6e-05
 Identities = 20/52 (38%), Positives = 32/52 (61%), Gaps = 2/52 (3%)
 Frame = +1

Query: 106 LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVG--MGQKDSYVGDE 255
           +++DNG+G  K G+AG+DAP  VFP+++   R  G   G  +  K SY+  +
Sbjct: 8   IIMDNGTGYSKLGYAGNDAPSYVFPTVIA-TRSAGASSGPAVSSKPSYMASK 58


>SPAC11H11.06 |arp2|SPAC22F8.01|ARP2/3 actin-organizing complex
           subunit Arp2|Schizosaccharomyces pombe|chr 1|||Manual
          Length = 390

 Score = 98.7 bits (235), Expect = 9e-22
 Identities = 41/85 (48%), Positives = 64/85 (75%)
 Frame = +3

Query: 255 AQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANRE 434
           A++ R +L +KYP+E+GI+ ++++M ++W +TF+ +L++ P    +LLTE P+NP ANRE
Sbjct: 58  AEAVRSLLQVKYPMENGIIRDFEEMNQLWDYTFFEKLKIDPRGRKILLTEPPMNPVANRE 117

Query: 435 KMTQIMFETFNTPAMYVAIQAVLSL 509
           KM + MFE +    +YVAIQAVLSL
Sbjct: 118 KMCETMFERYGFGGVYVAIQAVLSL 142



 Score = 76.2 bits (179), Expect = 6e-15
 Identities = 38/79 (48%), Positives = 51/79 (64%), Gaps = 1/79 (1%)
 Frame = +2

Query: 509 YASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDFSRSRLTDYLMKILTERGYSFIT 688
           YA G ++G+V+DSGDGV+H VP+YE   L H + RLD +    T YL+ +L  +GY+F  
Sbjct: 143 YAQGLSSGVVVDSGDGVTHIVPVYESVVLNHLVGRLDVAGRDATRYLISLLLRKGYAFNR 202

Query: 689 NAXRE-IRS*TFKEKLCYV 742
            A  E +R    KEKLCYV
Sbjct: 203 TADFETVRE--MKEKLCYV 219



 Score = 52.4 bits (120), Expect = 8e-08
 Identities = 29/59 (49%), Positives = 36/59 (61%), Gaps = 2/59 (3%)
 Frame = +1

Query: 94  EVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRP--RHQGVMVGMGQKDSYVGDEHRA 264
           E A +V+DNG+G  K G+A D+ PR  FPSIVGRP  R +     +  KD  VGDE  A
Sbjct: 2   ESAPIVLDNGTGFVKVGYAKDNFPRFQFPSIVGRPILRAEEKTGNVQIKDVMVGDEAEA 60


>SPBC1347.12 |||actin-like protein Arp1 |Schizosaccharomyces
           pombe|chr 2|||Manual
          Length = 379

 Score = 92.7 bits (220), Expect = 6e-20
 Identities = 41/86 (47%), Positives = 60/86 (69%), Gaps = 1/86 (1%)
 Frame = +3

Query: 255 AQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNE-LRVAPEEHPVLLTEAPLNPKANR 431
           AQ+ RG+L ++ PIE GI+ NW DME+IW + + ++ L   PEEHP+LLTE PL    N+
Sbjct: 62  AQNLRGLLKIQRPIERGIIQNWSDMEEIWSYIYSDQQLNTLPEEHPLLLTEPPLANIRNK 121

Query: 432 EKMTQIMFETFNTPAMYVAIQAVLSL 509
           EK+ +  +ET N PA+  ++Q VL+L
Sbjct: 122 EKIAEYFYETLNVPALSFSLQPVLAL 147



 Score = 81.0 bits (191), Expect = 2e-16
 Identities = 38/80 (47%), Positives = 55/80 (68%)
 Frame = +2

Query: 509 YASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDFSRSRLTDYLMKILTERGYSFIT 688
           YAS RTTGIVL+ GDG++H+VPIY+G+++P AI + +     +TDYL   L + G+  ++
Sbjct: 148 YASARTTGIVLECGDGLTHSVPIYDGFSIPSAIQQEEIGGRDVTDYLQLQLRKSGHELVS 207

Query: 689 NAXREIRS*TFKEKLCYVGS 748
           +A +EI     KEK CYV S
Sbjct: 208 SAEKEIVR-EIKEKCCYVAS 226



 Score = 65.7 bits (153), Expect = 8e-12
 Identities = 28/50 (56%), Positives = 36/50 (72%)
 Frame = +1

Query: 106 LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDE 255
           + +DNGSG  KAGFAGDD P+ +FP+ VGR +H+ VM    QKD +VG E
Sbjct: 12  ICIDNGSGFIKAGFAGDDIPKCLFPTCVGRIKHERVMPSSIQKDMFVGSE 61


>SPBP23A10.08 |alp5|arp4|actin-like protein Arp4|Schizosaccharomyces
           pombe|chr 2|||Manual
          Length = 433

 Score = 63.3 bits (147), Expect = 4e-11
 Identities = 29/73 (39%), Positives = 41/73 (56%)
 Frame = +3

Query: 276 LTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMF 455
           + +K  I +G V NWD    +W +    +L+  P EHP+L+TE   NP  NR K  + MF
Sbjct: 63  MEIKNAIRNGWVENWDVTVDLWRYGLEQQLKTNPLEHPILITEPFDNPPENRVKTLETMF 122

Query: 456 ETFNTPAMYVAIQ 494
           E+   PA Y+A Q
Sbjct: 123 ESLRCPATYLAKQ 135



 Score = 40.3 bits (90), Expect = 3e-04
 Identities = 16/34 (47%), Positives = 24/34 (70%)
 Frame = +1

Query: 91  EEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVG 192
           +EV+A+V+D GS   + GF+G+D P+ V PS  G
Sbjct: 9   DEVSAIVIDPGSKWTRIGFSGEDIPKCVLPSYCG 42



 Score = 33.5 bits (73), Expect = 0.039
 Identities = 17/57 (29%), Positives = 29/57 (50%)
 Frame = +2

Query: 506 AYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDFSRSRLTDYLMKILTERGY 676
           A+ASG+ T  ++D G   S    IY+G+ L        FS + + D L + L ++ +
Sbjct: 140 AFASGKGTACLVDIGAERSSVSAIYDGFVLQKGYQVQHFSGNAINDILAQTLRDKNF 196


>SPBC365.10 |||actin-like protein Arp5 |Schizosaccharomyces
           pombe|chr 2|||Manual
          Length = 721

 Score = 61.3 bits (142), Expect = 2e-10
 Identities = 28/82 (34%), Positives = 45/82 (54%)
 Frame = +3

Query: 291 PIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNT 470
           P E  +++NWD ME++  +TF  +L +   EHP+ +TE   NP   R  MT+++FE +N 
Sbjct: 86  PFERNVISNWDLMEQVLDYTFL-KLGIDRMEHPICMTEPLANPTYVRSTMTELLFELYNA 144

Query: 471 PAMYVAIQAVLSLTRPVVPPVS 536
           P++   I  + S      P  S
Sbjct: 145 PSVAYGIDGLFSFYHNTKPSSS 166



 Score = 35.9 bits (79), Expect = 0.007
 Identities = 15/32 (46%), Positives = 22/32 (68%)
 Frame = +1

Query: 106 LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPR 201
           LV+DNGS   +AG+ G+  P+ VF ++V R R
Sbjct: 27  LVIDNGSWQLRAGWGGEKDPKLVFDNLVSRYR 58



 Score = 35.9 bits (79), Expect = 0.007
 Identities = 16/53 (30%), Positives = 30/53 (56%)
 Frame = +2

Query: 524 TTGIVLDSGDGVSHTVPIYEGYALPHAILRLDFSRSRLTDYLMKILTERGYSF 682
           ++GIVL+ G+  SH +P+  G  +     R+ +  S+ + YL+K+   +  SF
Sbjct: 165 SSGIVLNLGNAASHVIPVLNGERILSEAKRISWGGSQSSSYLLKLFQIKYPSF 217


>SPAC23D3.09 |arp42|arp4|SWI/SNF and RSC complex subunit
           Arp42|Schizosaccharomyces pombe|chr 1|||Manual
          Length = 430

 Score = 51.6 bits (118), Expect = 1e-07
 Identities = 21/67 (31%), Positives = 39/67 (58%)
 Frame = +3

Query: 300 HGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAM 479
           +GI+ +W+     W      +L+V P E+ +++TE   NP++ R+++ +  FE  + PA 
Sbjct: 74  NGIIQDWESTLYTWERGLKEKLQVNPTEYAMMITEPSWNPQSVRQQIMEAAFEQLHVPAF 133

Query: 480 YVAIQAV 500
           Y+  QAV
Sbjct: 134 YLTKQAV 140



 Score = 37.1 bits (82), Expect = 0.003
 Identities = 19/55 (34%), Positives = 32/55 (58%)
 Frame = +1

Query: 91  EEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDE 255
           EE+ +LV+D GS   + G+AG+++P  + PS      + GV   +  ++ YV DE
Sbjct: 8   EEIPSLVIDPGSCWTRFGYAGEESPMTILPS------YYGVRSDVTGRNKYVVDE 56


>SPCC550.12 |arp6||actin-like protein Arp6|Schizosaccharomyces
           pombe|chr 3|||Manual
          Length = 401

 Score = 41.1 bits (92), Expect = 2e-04
 Identities = 23/72 (31%), Positives = 39/72 (54%), Gaps = 2/72 (2%)
 Frame = +2

Query: 533 IVLDSGDGVSHTVPIYEGYALPHAILRLDFSRSRLTDYLMKILTERGYSFI--TNAXREI 706
           +V+DSG   +H +P+ +      A+ R+D     LT+YL ++++ R Y+ +  T    EI
Sbjct: 159 LVIDSGYSFTHIIPVIDFSVQEQAVKRVDVGGKLLTNYLKEVISYRKYNMMEETYIVNEI 218

Query: 707 RS*TFKEKLCYV 742
                KE +CYV
Sbjct: 219 -----KESVCYV 225


>SPAC1071.06 |arp9||SWI/SNF and RSC complex subunit
           Arp9|Schizosaccharomyces pombe|chr 1|||Manual
          Length = 523

 Score = 37.1 bits (82), Expect = 0.003
 Identities = 22/77 (28%), Positives = 35/77 (45%), Gaps = 4/77 (5%)
 Frame = +3

Query: 291 PIEHGIVTNWDDMEKIWHHTFYNELRVAPEE----HPVLLTEAPLNPKANREKMTQIMFE 458
           PI+ G V +W+ ++  W H  Y+ L   P +    +PV L         +RE  TQ  FE
Sbjct: 113 PIQRGRVVDWEALKAFWKH-LYSLLLKDPNDTTFRYPVCLVIPTYWSLYDRELATQFFFE 171

Query: 459 TFNTPAMYVAIQAVLSL 509
               P   +A + ++ L
Sbjct: 172 ECQVPGFTIAYEPLMGL 188


>SPAC26A3.05 |chc1||clathrin heavy chain Chc1 |Schizosaccharomyces
            pombe|chr 1|||Manual
          Length = 1666

 Score = 31.9 bits (69), Expect = 0.12
 Identities = 19/53 (35%), Positives = 31/53 (58%), Gaps = 5/53 (9%)
 Frame = +3

Query: 351  FYNELRVAPEEHPVLLTE--APLNPKANREKMTQIMFETFNTPAM---YVAIQ 494
            +Y  L    E+HP+LLT+  A L P+ +  ++ +I  ++ NTP +    VAIQ
Sbjct: 1399 YYRALNFYLEQHPMLLTDLLAALTPRIDHPRVIRIFEKSENTPLILNFMVAIQ 1451


>SPAPB24D3.07c |||sequence orphan|Schizosaccharomyces pombe|chr
           1|||Manual
          Length = 300

 Score = 30.7 bits (66), Expect = 0.28
 Identities = 19/49 (38%), Positives = 26/49 (53%), Gaps = 3/49 (6%)
 Frame = +3

Query: 606 SCVWTLAGR---DSQTTS*RFSPSAATRSLPTPXGKFVREHSRRSCATS 743
           S VWTL G     S TT+  +  +A+  S+PTP    V  ++  SC TS
Sbjct: 3   SFVWTLLGALSLGSLTTA--YGANASNSSVPTPDNTLVVSYTNTSCYTS 49


>SPAPB18E9.04c |||sequence orphan|Schizosaccharomyces pombe|chr
           1|||Manual
          Length = 800

 Score = 29.9 bits (64), Expect = 0.48
 Identities = 19/55 (34%), Positives = 23/55 (41%), Gaps = 1/55 (1%)
 Frame = -3

Query: 248 PT*ESFCPI-PTITP*WRGLPTIEGNTARGASSPAKPALHIPEPLSTTNAATSSS 87
           PT  S  P+ PT+ P     P    N     S P         PL+TTN  TS+S
Sbjct: 401 PTGNSTTPVTPTVPPTSSSTPLTTTNCTTSTSVPYTSTPVTSTPLATTNCTTSTS 455



 Score = 27.9 bits (59), Expect = 1.9
 Identities = 21/61 (34%), Positives = 26/61 (42%), Gaps = 1/61 (1%)
 Frame = +3

Query: 516 PVVPPVS-CWTPATVSPTPCPSTRDTHSPTPSCVWTLAGRDSQTTS*RFSPSAATRSLPT 692
           P VPP S   T   + PT   ST    +P P+         S TTS    P+  + SL T
Sbjct: 136 PTVPPTSTSSTSIPIPPTSTSSTDTNSNPLPTT------STSCTTSTSIPPTGGSSSLST 189

Query: 693 P 695
           P
Sbjct: 190 P 190


>SPAC13F5.04c |||endosomal sorting protein |Schizosaccharomyces
           pombe|chr 1|||Manual
          Length = 277

 Score = 29.1 bits (62), Expect = 0.84
 Identities = 18/66 (27%), Positives = 30/66 (45%)
 Frame = -3

Query: 323 IPVSDDSVFDGVFEGQDTSFALCSSPT*ESFCPIPTITP*WRGLPTIEGNTARGASSPAK 144
           +P  + +V        +TSFAL ++    S    PT +      P +E +    +S+PA 
Sbjct: 63  LPTQEAAVETNASASHETSFALPTTSPAASLSISPTKSAAVSSEPNVEADVKSLSSTPAA 122

Query: 143 PALHIP 126
           P L+ P
Sbjct: 123 PQLNSP 128


>SPBC8D2.20c |sec31||COPII-coated vesicle component Sec31
            |Schizosaccharomyces pombe|chr 2|||Manual
          Length = 1224

 Score = 27.5 bits (58), Expect = 2.6
 Identities = 24/80 (30%), Positives = 29/80 (36%)
 Frame = +3

Query: 456  ETFNTPAMYVAIQAVLSLTRPVVPPVSCWTPATVSPTPCPSTRDTHSPTPSCVWTLAGRD 635
            +T    ++   +    S T P     S  TPA V P P PST  T        W  A   
Sbjct: 815  KTSQASSILPTVPRTTSYTSPYATTSSHITPADVHPLPPPSTSTTAG------WNDAPML 868

Query: 636  SQTTS*RFSPSAATRSLPTP 695
             Q    R +PS A    P P
Sbjct: 869  GQLPMRRAAPSMAPVRSPFP 888


>SPAC20G8.05c |cdc15||cell division control protein
           Cdc15|Schizosaccharomyces pombe|chr 1|||Manual
          Length = 927

 Score = 27.5 bits (58), Expect = 2.6
 Identities = 13/27 (48%), Positives = 15/27 (55%)
 Frame = -1

Query: 250 LLHKSPSVPYRPSRPDGGAFPRSRGTR 170
           L+ K+PS PY  SRP   A   S  TR
Sbjct: 309 LISKAPSYPYSSSRPSASASLASSPTR 335


>SPAC23A1.17 |||WIP homolog|Schizosaccharomyces pombe|chr 1|||Manual
          Length = 1611

 Score = 27.1 bits (57), Expect = 3.4
 Identities = 14/46 (30%), Positives = 18/46 (39%)
 Frame = +3

Query: 471  PAMYVAIQAVLSLTRPVVPPVSCWTPATVSPTPCPSTRDTHSPTPS 608
            P    A    +  + P VP  S   P+   P P PS+     P PS
Sbjct: 1035 PVPSTAPPVPIPTSTPPVPKSSSGAPSAPPPVPAPSSEIPSIPAPS 1080


>SPBC13E7.09 |vrp1||verprolin|Schizosaccharomyces pombe|chr
           2|||Manual
          Length = 309

 Score = 26.6 bits (56), Expect = 4.5
 Identities = 17/41 (41%), Positives = 21/41 (51%), Gaps = 2/41 (4%)
 Frame = -3

Query: 251 SPT*ESFC--PIPTITP*WRGLPTIEGNTARGASSPAKPAL 135
           S T +SF   P+PT  P    LPT   NT +    P+ PAL
Sbjct: 64  SNTPKSFAAPPVPTGAP---SLPTSSNNTQQAEERPSMPAL 101


>SPAC56F8.02 |||AMP binding enzyme |Schizosaccharomyces pombe|chr
           1|||Manual
          Length = 1517

 Score = 26.2 bits (55), Expect = 5.9
 Identities = 13/35 (37%), Positives = 20/35 (57%)
 Frame = +1

Query: 151 GDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDE 255
           G+  PRA F  ++  P H G+++ M  KD   G+E
Sbjct: 502 GNQNPRATFVPLLCLPEHGGMVISM--KDWIGGEE 534


>SPBC115.01c |rrp46||exosome subunit Rrp46 |Schizosaccharomyces
           pombe|chr 2|||Manual
          Length = 226

 Score = 26.2 bits (55), Expect = 5.9
 Identities = 10/25 (40%), Positives = 18/25 (72%)
 Frame = +3

Query: 393 LLTEAPLNPKANREKMTQIMFETFN 467
           +L  APL+ +   +KM +++FET+N
Sbjct: 181 VLETAPLHAEEVSKKMKELLFETYN 205


>SPBC3E7.12c |chr1|cfh4|chitin synthase regulatory factor
           |Schizosaccharomyces pombe|chr 2|||Manual
          Length = 456

 Score = 25.8 bits (54), Expect = 7.8
 Identities = 19/64 (29%), Positives = 25/64 (39%), Gaps = 1/64 (1%)
 Frame = +3

Query: 573 PSTRDTHSPTPSCVWTLAGRDSQTTS*RFSPSAATRS-LPTPXGKFVREHSRRSCATSAL 749
           P T + H    S  W+L+  DS  +    S   +  S L  P   F    S  S + SA 
Sbjct: 56  PETNNAHEEVSSSSWSLSSSDSIMSYDSLSDDVSVLSFLDCPLTTFETAPSIASFSNSAA 115

Query: 750 DFRS 761
           D  S
Sbjct: 116 DVSS 119


>SPAC6G10.10c |||human hmmtag2 homolog|Schizosaccharomyces pombe|chr
           1|||Manual
          Length = 194

 Score = 25.8 bits (54), Expect = 7.8
 Identities = 20/44 (45%), Positives = 23/44 (52%), Gaps = 4/44 (9%)
 Frame = +1

Query: 460 HST-RPPCTSPSKPCSRL---RVRSYHRYRAGLRRRCLPHRAHL 579
           HST R   TSP+    R    R RS HR+  G  RR  P+R HL
Sbjct: 121 HSTSRSRSTSPANRHRRKEKERTRSNHRH--GSHRRHEPYRTHL 162


  Database: spombe
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 2,362,478
  Number of sequences in database:  5004
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 3,606,625
Number of Sequences: 5004
Number of extensions: 80161
Number of successful extensions: 269
Number of sequences better than 10.0: 21
Number of HSP's better than 10.0 without gapping: 220
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 264
length of database: 2,362,478
effective HSP length: 72
effective length of database: 2,002,190
effective search space used: 424464280
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -