SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= psV30134.Seq
         (882 letters)

Database: spombe 
           5004 sequences; 2,362,478 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SPAC23E2.03c |ste7||meiotic suppressor protein Ste7|Schizosaccha...    27   4.7  
SPAC23E2.02 |lsd2|swm2, saf140|histone demethylase SWIRM2 |Schiz...    26   6.2  
SPBC17D1.07c |||GTPase regulator |Schizosaccharomyces pombe|chr ...    26   6.2  
SPAC17C9.07 |alg8||glucosyltransferase Alg8|Schizosaccharomyces ...    26   8.2  
SPCC1739.11c |cdc11||SIN component scaffold protein Cdc11|Schizo...    26   8.2  

>SPAC23E2.03c |ste7||meiotic suppressor protein
           Ste7|Schizosaccharomyces pombe|chr 1|||Manual
          Length = 569

 Score = 26.6 bits (56), Expect = 4.7
 Identities = 13/45 (28%), Positives = 22/45 (48%)
 Frame = -1

Query: 258 PVTRGSHIRCADFFDAPQSRWNER*TGAVGFYPYSH*NYTSKNLS 124
           P T  S +  ++ FD+  + +N   TG    Y +   +YT+ N S
Sbjct: 314 PSTPSSAVTLSNGFDSQSNAYNNSGTGPPMLYKFPQRSYTAPNTS 358


>SPAC23E2.02 |lsd2|swm2, saf140|histone demethylase SWIRM2
           |Schizosaccharomyces pombe|chr 1|||Manual
          Length = 1273

 Score = 26.2 bits (55), Expect = 6.2
 Identities = 22/65 (33%), Positives = 31/65 (47%), Gaps = 4/65 (6%)
 Frame = -1

Query: 258 PVTRGSHIRCADFFDAPQSRWNE----R*TGAVGFYPYSH*NYTSKNLSA*HFQLSPNTD 91
           P+ R S I CA +F   +SR+NE    R T  V FY  +    TS+N    H+     T+
Sbjct: 2   PLGRSSWICCAKYFVNTKSRFNEILPPRFTLIVSFYSMN----TSENDPDGHYDFPEMTE 57

Query: 90  TTAQR 76
             + R
Sbjct: 58  HHSDR 62


>SPBC17D1.07c |||GTPase regulator |Schizosaccharomyces pombe|chr
           2|||Manual
          Length = 962

 Score = 26.2 bits (55), Expect = 6.2
 Identities = 20/57 (35%), Positives = 28/57 (49%), Gaps = 3/57 (5%)
 Frame = -3

Query: 511 KISSIKMALKLXHIFLISKLFSKLPNL*RRNTLLS---RHETASSSHRVANVXPVPA 350
           K S +  A K   +   +K F   P L  +N   S   RHETA+S+ +V+    VPA
Sbjct: 189 KKSQLNTATKEISLLKKAKKFPNFPKL--KNFFCSYSHRHETATSNKQVSCFREVPA 243


>SPAC17C9.07 |alg8||glucosyltransferase Alg8|Schizosaccharomyces
           pombe|chr 1|||Manual
          Length = 501

 Score = 25.8 bits (54), Expect = 8.2
 Identities = 16/57 (28%), Positives = 28/57 (49%)
 Frame = +2

Query: 509 FVSPSNITIDHLH*LIGNVLNGKNLFVFYVILGINNFNQYIFAHVASFVIIWMTILI 679
           F+SP  + IDH+H      L G  L ++ ++L     N  + A + S +I +  I +
Sbjct: 139 FLSPGLLIIDHIHFQYNGFLFG--LLLWSIVLAKPEKNMLLSAAIFSALICFKHIFL 193


>SPCC1739.11c |cdc11||SIN component scaffold protein
           Cdc11|Schizosaccharomyces pombe|chr 3|||Manual
          Length = 1045

 Score = 25.8 bits (54), Expect = 8.2
 Identities = 11/25 (44%), Positives = 15/25 (60%)
 Frame = -2

Query: 140 QAKTFPLNISN*VQIQTPPHSVRDS 66
           Q  +FPL   N  Q + P HS+RD+
Sbjct: 501 QPHSFPLRKQNVAQSEFPKHSLRDN 525


  Database: spombe
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 2,362,478
  Number of sequences in database:  5004
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 3,639,858
Number of Sequences: 5004
Number of extensions: 74829
Number of successful extensions: 192
Number of sequences better than 10.0: 5
Number of HSP's better than 10.0 without gapping: 175
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 192
length of database: 2,362,478
effective HSP length: 72
effective length of database: 2,002,190
effective search space used: 442483990
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -