SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= psV30132.Seq
         (689 letters)

Database: spombe 
           5004 sequences; 2,362,478 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SPCC736.14 |dis1||microtubule-associated protein Dis1 |Schizosac...    30   0.27 
SPBC28E12.03 |rga4||GTPase activating protein Rga4|Schizosacchar...    29   0.84 
SPBC19G7.07c |||conserved fungal protein|Schizosaccharomyces pom...    28   1.1  
SPAC343.14c |||translation initiation factor eIF2B|Schizosacchar...    27   1.9  
SPAC4H3.11c |ppc89|mug127|spindle pole body protein Ppc89|Schizo...    27   3.4  
SPAC13G6.01c |rad8|SPAC5H10.14c|ubiquitin-protein ligase E3 |Sch...    26   4.5  
SPAPB18E9.04c |||sequence orphan|Schizosaccharomyces pombe|chr 1...    26   4.5  
SPAC57A7.05 |||conserved protein |Schizosaccharomyces pombe|chr ...    26   4.5  
SPAC14C4.06c |||poly|Schizosaccharomyces pombe|chr 1|||Manual          26   5.9  
SPBC1683.08 |ght4||hexose transporter Ght4 |Schizosaccharomyces ...    25   7.8  

>SPCC736.14 |dis1||microtubule-associated protein Dis1
           |Schizosaccharomyces pombe|chr 3|||Manual
          Length = 882

 Score = 30.3 bits (65), Expect = 0.27
 Identities = 26/80 (32%), Positives = 39/80 (48%), Gaps = 2/80 (2%)
 Frame = +2

Query: 293 STQTGPSGL-VESLEMVRRGIILEQAANQRPLKGILNAASALDAFK*STRITKLKLTSRP 469
           S+ T PS   + S  +V R       A     KG+ NAAS+  +F  S  I+K   TSR 
Sbjct: 589 SSPTKPSTTSLRSQSLVNRFASSTLKAPSSSSKGVSNAASSKQSFPSSPSISKKLETSRL 648

Query: 470 SIVTVP-SAIFATRSIVQHP 526
           S   +P S + A  ++ ++P
Sbjct: 649 STKKLPGSTMKAASALKEYP 668


>SPBC28E12.03 |rga4||GTPase activating protein
           Rga4|Schizosaccharomyces pombe|chr 2|||Manual
          Length = 933

 Score = 28.7 bits (61), Expect = 0.84
 Identities = 10/39 (25%), Positives = 20/39 (51%)
 Frame = +1

Query: 409 CSRCLQMINENNKIEIDKQAFHSHCAKCYFCHTVHRPTS 525
           C +C + +   +++    + +HS C KC  C+    P+S
Sbjct: 24  CIKCWESVPSTSQVWFGGKCWHSDCFKCVNCNKKLDPSS 62


>SPBC19G7.07c |||conserved fungal protein|Schizosaccharomyces
           pombe|chr 2|||Manual
          Length = 687

 Score = 28.3 bits (60), Expect = 1.1
 Identities = 12/19 (63%), Positives = 13/19 (68%)
 Frame = +3

Query: 546 FCEPCFQHHVLHRHKDNPN 602
           FC PC +   LH HKDNPN
Sbjct: 17  FCGPCRR---LHYHKDNPN 32


>SPAC343.14c |||translation initiation factor
          eIF2B|Schizosaccharomyces pombe|chr 1|||Manual
          Length = 393

 Score = 27.5 bits (58), Expect = 1.9
 Identities = 12/22 (54%), Positives = 14/22 (63%)
 Frame = +2

Query: 32 HTYPKKSSLIMDKGQEQVKKPF 97
          HTYP  SSLI D    +V+ PF
Sbjct: 8  HTYPAVSSLIADLKSRKVQGPF 29


>SPAC4H3.11c |ppc89|mug127|spindle pole body protein
           Ppc89|Schizosaccharomyces pombe|chr 1|||Manual
          Length = 783

 Score = 26.6 bits (56), Expect = 3.4
 Identities = 12/40 (30%), Positives = 24/40 (60%)
 Frame = +1

Query: 349 DNPGASSKSEASEGNTKRSVCSRCLQMINENNKIEIDKQA 468
           D+P  +S  E+ EG+ + S+ S    +++++   E +KQA
Sbjct: 557 DSPNVASGVESDEGSEEISLDSEYSDILSDDGDFEKEKQA 596


>SPAC13G6.01c |rad8|SPAC5H10.14c|ubiquitin-protein ligase E3
           |Schizosaccharomyces pombe|chr 1|||Manual
          Length = 1133

 Score = 26.2 bits (55), Expect = 4.5
 Identities = 11/26 (42%), Positives = 15/26 (57%)
 Frame = -1

Query: 317 VHWAQFVWTDGHSPLNRSSTCA*SIH 240
           VHW + V  +GH+  NR S  A + H
Sbjct: 648 VHWFRVVLDEGHNIRNRESKTAKACH 673


>SPAPB18E9.04c |||sequence orphan|Schizosaccharomyces pombe|chr
           1|||Manual
          Length = 800

 Score = 26.2 bits (55), Expect = 4.5
 Identities = 15/45 (33%), Positives = 20/45 (44%)
 Frame = +1

Query: 517 PTSTSAMVKSSASLASNITSCTDIRTTPMXXXXXXXXXXRTPDLP 651
           PTSTS+   +S  L +  TSCT   + P            TP +P
Sbjct: 152 PTSTSSTDTNSNPLPTTSTSCTTSTSIPPTGGSSSLSTPITPTVP 196



 Score = 26.2 bits (55), Expect = 4.5
 Identities = 13/28 (46%), Positives = 16/28 (57%)
 Frame = +1

Query: 517 PTSTSAMVKSSASLASNITSCTDIRTTP 600
           P STS+   SS+ L S  TSCT   + P
Sbjct: 319 PASTSSTGTSSSPLPSTSTSCTTSTSIP 346



 Score = 26.2 bits (55), Expect = 4.5
 Identities = 13/28 (46%), Positives = 16/28 (57%)
 Frame = +1

Query: 517 PTSTSAMVKSSASLASNITSCTDIRTTP 600
           P STS+   SS+ L S  TSCT   + P
Sbjct: 373 PASTSSTGTSSSPLLSTSTSCTTSTSIP 400



 Score = 25.8 bits (54), Expect = 5.9
 Identities = 12/28 (42%), Positives = 17/28 (60%)
 Frame = +1

Query: 517 PTSTSAMVKSSASLASNITSCTDIRTTP 600
           PTSTS+   +S+ L +  TSCT   + P
Sbjct: 209 PTSTSSTDTNSSPLPTTSTSCTTSTSIP 236



 Score = 25.8 bits (54), Expect = 5.9
 Identities = 12/28 (42%), Positives = 17/28 (60%)
 Frame = +1

Query: 517 PTSTSAMVKSSASLASNITSCTDIRTTP 600
           PTSTS+   +S+ L +  TSCT   + P
Sbjct: 265 PTSTSSTDTNSSPLPTTSTSCTTSTSIP 292


>SPAC57A7.05 |||conserved protein |Schizosaccharomyces pombe|chr
           1|||Manual
          Length = 1337

 Score = 26.2 bits (55), Expect = 4.5
 Identities = 12/29 (41%), Positives = 17/29 (58%)
 Frame = -1

Query: 281 SPLNRSSTCA*SIHCRIRARRTSSPPTEL 195
           S  N SST + S H +I + R S PP ++
Sbjct: 26  SSSNNSSTASGSRHVKIESNRVSLPPLKI 54


>SPAC14C4.06c |||poly|Schizosaccharomyces pombe|chr 1|||Manual
          Length = 307

 Score = 25.8 bits (54), Expect = 5.9
 Identities = 16/62 (25%), Positives = 24/62 (38%)
 Frame = +1

Query: 379 ASEGNTKRSVCSRCLQMINENNKIEIDKQAFHSHCAKCYFCHTVHRPTSTSAMVKSSASL 558
           A+  N  +SV     + + +  ++ + K A     A C F H          MV SS   
Sbjct: 158 AASFNYSKSVMPAAKRALTQTQEVPLCKYADKCSRANCIFAHPTPAAAPGEGMVLSSEMC 217

Query: 559 AS 564
           AS
Sbjct: 218 AS 219


>SPBC1683.08 |ght4||hexose transporter Ght4 |Schizosaccharomyces
           pombe|chr 2|||Manual
          Length = 557

 Score = 25.4 bits (53), Expect = 7.8
 Identities = 14/37 (37%), Positives = 21/37 (56%)
 Frame = +1

Query: 334 NGQEGDNPGASSKSEASEGNTKRSVCSRCLQMINENN 444
           +G + D+  ASS+S AS G   RSV  R   +  E++
Sbjct: 517 DGADNDDSSASSESFASAGAHSRSVFPRRSNVSEESH 553


  Database: spombe
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 2,362,478
  Number of sequences in database:  5004
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 2,934,997
Number of Sequences: 5004
Number of extensions: 61162
Number of successful extensions: 182
Number of sequences better than 10.0: 10
Number of HSP's better than 10.0 without gapping: 171
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 182
length of database: 2,362,478
effective HSP length: 70
effective length of database: 2,012,198
effective search space used: 319939482
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -