SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= psV30131.Seq
         (482 letters)

Database: spombe 
           5004 sequences; 2,362,478 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SPAPJ698.02c |rps002|rpsa-2, rps0-2, rps0|40S ribosomal protein ...   121   7e-29
SPBC685.06 |rps001|rps0-1, rpsa-1, rps0|40S ribosomal protein S0...   119   3e-28
SPCC663.03 |pmd1||leptomycin efflux transporter Pmd1|Schizosacch...    26   3.4  
SPAC24H6.10c |||phospho-2-dehydro-3-deoxyheptonate aldolase |Sch...    26   3.4  
SPAC1952.06c |||DUF1716 family protein|Schizosaccharomyces pombe...    25   4.5  
SPBC15C4.04c |||amino acid permease, unknown 10|Schizosaccharomy...    25   6.0  
SPAC222.10c |byr4||two-component GAP Byr4|Schizosaccharomyces po...    25   7.9  

>SPAPJ698.02c |rps002|rpsa-2, rps0-2, rps0|40S ribosomal protein
           S0B|Schizosaccharomyces pombe|chr 1|||Manual
          Length = 287

 Score =  121 bits (291), Expect = 7e-29
 Identities = 60/84 (71%), Positives = 65/84 (77%)
 Frame = +3

Query: 3   KLVLAARAVVAIENPADVFVISSRXFGQRAVLKFAAHTGATPIAGRFTPGAFTNQIQAAF 182
           KLVLAAR +  IENPADV VISSR +G RAVLKFAAHTGAT IAGRFTPG FTN I   +
Sbjct: 60  KLVLAARVIATIENPADVCVISSRPYGHRAVLKFAAHTGATAIAGRFTPGNFTNYITRTY 119

Query: 183 REPRLLIVLDPAQXHQPITEASYV 254
           REPRL+IV DP    Q I EAS+V
Sbjct: 120 REPRLIIVTDPRADAQAIKEASFV 143



 Score = 80.2 bits (189), Expect = 2e-16
 Identities = 39/80 (48%), Positives = 49/80 (61%)
 Frame = +2

Query: 242 SFICXIPVIAXCNTDSPLXFVDIAIPCNTKSSHSIGLMWWXXXXXXXXXXXXXPRDQXWD 421
           SF+  IPVIA C+TDS L  VD+AIP N K   SIGL W+              R   W+
Sbjct: 141 SFV-NIPVIALCDTDSILNHVDVAIPINNKGYKSIGLAWYLLAREVLRLRGNISRTTAWE 199

Query: 422 VVVDLFFYRDPEESEKDEQQ 481
           V+ DL+FYRDPEE E++E+Q
Sbjct: 200 VMPDLYFYRDPEEIEREEEQ 219


>SPBC685.06 |rps001|rps0-1, rpsa-1, rps0|40S ribosomal protein S0A
           |Schizosaccharomyces pombe|chr 2|||Manual
          Length = 292

 Score =  119 bits (286), Expect = 3e-28
 Identities = 57/84 (67%), Positives = 65/84 (77%)
 Frame = +3

Query: 3   KLVLAARAVVAIENPADVFVISSRXFGQRAVLKFAAHTGATPIAGRFTPGAFTNQIQAAF 182
           KLVLAAR +  IENPADV V+S+R +G RAVLKFAAHTGAT IAGRFTPG FTN I   +
Sbjct: 59  KLVLAARVIATIENPADVCVVSTRTYGHRAVLKFAAHTGATAIAGRFTPGNFTNYITRTY 118

Query: 183 REPRLLIVLDPAQXHQPITEASYV 254
           REPRL++V DP    Q I EAS+V
Sbjct: 119 REPRLIVVTDPRADAQAIKEASFV 142



 Score = 81.8 bits (193), Expect = 5e-17
 Identities = 40/79 (50%), Positives = 49/79 (62%)
 Frame = +2

Query: 242 SFICXIPVIAXCNTDSPLXFVDIAIPCNTKSSHSIGLMWWXXXXXXXXXXXXXPRDQXWD 421
           SF+  IPVIA C+TDS L  VDIAIP N K   SIGL+W+              R   WD
Sbjct: 140 SFV-NIPVIALCDTDSILNHVDIAIPTNNKGRKSIGLIWYLLAREVLRVRGTLSRSAPWD 198

Query: 422 VVVDLFFYRDPEESEKDEQ 478
           V+ DL+FYRDPEE E++E+
Sbjct: 199 VMPDLYFYRDPEEVEREEE 217


>SPCC663.03 |pmd1||leptomycin efflux transporter
           Pmd1|Schizosaccharomyces pombe|chr 3|||Manual
          Length = 1362

 Score = 25.8 bits (54), Expect = 3.4
 Identities = 15/53 (28%), Positives = 26/53 (49%)
 Frame = +1

Query: 178 HSVNLVS*LYWTLHXTINPLLKLHMSXSCDCFXQHRLPTXICGHCYPMQHQVF 336
           H +N ++ L W +H  +  ++++       C     L + ICG  YP+Q  VF
Sbjct: 771 HEINSLTAL-WFIHSFVRTMIEII------CLLIGILASMICGAAYPVQAAVF 816


>SPAC24H6.10c |||phospho-2-dehydro-3-deoxyheptonate aldolase
           |Schizosaccharomyces pombe|chr 1|||Manual
          Length = 368

 Score = 25.8 bits (54), Expect = 3.4
 Identities = 9/25 (36%), Positives = 14/25 (56%)
 Frame = +3

Query: 177 AFREPRLLIVLDPAQXHQPITEASY 251
           A R+ RLL+++ P   H P+    Y
Sbjct: 62  AGRDDRLLLIVGPCSLHDPVAAKEY 86


>SPAC1952.06c |||DUF1716 family protein|Schizosaccharomyces
           pombe|chr 1|||Manual
          Length = 564

 Score = 25.4 bits (53), Expect = 4.5
 Identities = 11/25 (44%), Positives = 15/25 (60%)
 Frame = +3

Query: 399 FPVTXAGMLWLICSSTVTLKKVKRM 473
           F  T   + WL   +TVTLKK+K +
Sbjct: 482 FQSTVLILSWLCVENTVTLKKIKML 506


>SPBC15C4.04c |||amino acid permease, unknown 10|Schizosaccharomyces
           pombe|chr 2|||Manual
          Length = 542

 Score = 25.0 bits (52), Expect = 6.0
 Identities = 10/29 (34%), Positives = 16/29 (55%)
 Frame = -2

Query: 190 GSRNAAWIWLVKAPGVKRPAIGVAPVXAA 104
           G+ +A W WL+   G    A+ VA + +A
Sbjct: 92  GAPSAVWCWLIAGAGCMCIALSVAELVSA 120


>SPAC222.10c |byr4||two-component GAP Byr4|Schizosaccharomyces
           pombe|chr 1|||Manual
          Length = 665

 Score = 24.6 bits (51), Expect = 7.9
 Identities = 11/30 (36%), Positives = 17/30 (56%)
 Frame = -3

Query: 441 KNKSTTTSQXWSRGSTPRSLSXSRANNHHI 352
           K+K   ++Q W   +TPRS S    N ++I
Sbjct: 414 KSKHAGSTQEWHSHTTPRSTSKHENNLNNI 443


  Database: spombe
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 2,362,478
  Number of sequences in database:  5004
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 1,881,523
Number of Sequences: 5004
Number of extensions: 33978
Number of successful extensions: 76
Number of sequences better than 10.0: 7
Number of HSP's better than 10.0 without gapping: 73
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 76
length of database: 2,362,478
effective HSP length: 68
effective length of database: 2,022,206
effective search space used: 186042952
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -